data_2JZ0 # _entry.id 2JZ0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JZ0 pdb_00002jz0 10.2210/pdb2jz0/pdb RCSB RCSB100467 ? ? WWPDB D_1000100467 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2JZ1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JZ0 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-12-21 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yang, Y.' 1 'Zhang, W.' 2 'Bayrer, J.R.' 3 'Weiss, M.A.' 4 # _citation.id primary _citation.title ;Doublesex and the Regulation of Sexual Dimorphism in Drosophila melanogaster: STRUCTURE, FUNCTION, AND MUTAGENESIS OF A FEMALE-SPECIFIC DOMAIN. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 283 _citation.page_first 7280 _citation.page_last 7292 _citation.year 2008 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18184648 _citation.pdbx_database_id_DOI 10.1074/jbc.M708742200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yang, Y.' 1 ? primary 'Zhang, W.' 2 ? primary 'Bayrer, J.R.' 3 ? primary 'Weiss, M.A.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein doublesex' _entity.formula_weight 7745.735 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 350-412' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSPLGQDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEGQYVVNEYSRQHNLN _entity_poly.pdbx_seq_one_letter_code_can GSPLGQDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEGQYVVNEYSRQHNLN _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PRO n 1 4 LEU n 1 5 GLY n 1 6 GLN n 1 7 ASP n 1 8 VAL n 1 9 PHE n 1 10 LEU n 1 11 ASP n 1 12 TYR n 1 13 CYS n 1 14 GLN n 1 15 LYS n 1 16 LEU n 1 17 LEU n 1 18 GLU n 1 19 LYS n 1 20 PHE n 1 21 ARG n 1 22 TYR n 1 23 PRO n 1 24 TRP n 1 25 GLU n 1 26 LEU n 1 27 MET n 1 28 PRO n 1 29 LEU n 1 30 MET n 1 31 TYR n 1 32 VAL n 1 33 ILE n 1 34 LEU n 1 35 LYS n 1 36 ASP n 1 37 ALA n 1 38 ASP n 1 39 ALA n 1 40 ASN n 1 41 ILE n 1 42 GLU n 1 43 GLU n 1 44 ALA n 1 45 SER n 1 46 ARG n 1 47 ARG n 1 48 ILE n 1 49 GLU n 1 50 GLU n 1 51 GLY n 1 52 GLN n 1 53 TYR n 1 54 VAL n 1 55 VAL n 1 56 ASN n 1 57 GLU n 1 58 TYR n 1 59 SER n 1 60 ARG n 1 61 GLN n 1 62 HIS n 1 63 ASN n 1 64 LEU n 1 65 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'fruit fly' _entity_src_gen.gene_src_genus Drosophila _entity_src_gen.pdbx_gene_src_gene dsx _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Drosophila melanogaster' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7227 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pMW127 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_code DSX_DROME _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P23023 _struct_ref.pdbx_align_begin 350 _struct_ref.pdbx_seq_one_letter_code PLGQDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEGQYVVNEYSRQHNLN _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2JZ0 A 3 ? 65 ? P23023 350 ? 412 ? 3 65 2 1 2JZ0 B 3 ? 65 ? P23023 350 ? 412 ? 3 65 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JZ0 GLY A 1 ? UNP P23023 ? ? 'expression tag' 1 1 1 2JZ0 SER A 2 ? UNP P23023 ? ? 'expression tag' 2 2 2 2JZ0 GLY B 1 ? UNP P23023 ? ? 'expression tag' 1 3 2 2JZ0 SER B 2 ? UNP P23023 ? ? 'expression tag' 2 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCACB' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D C(CO)NH' 1 5 1 '3D H(CCO)NH' 1 6 1 '3D HNCO' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' 1 9 2 'Filtered NOESY' 1 10 1 '4D 13C/13C edited NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 250 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '90 % H2O, 10 % D2O, 1 mM [U-100% 13C; U-100% 15N] protein, H2O' 1 H2O '90 % H2O, 10 % D2O, 1.2 mM [U-100% 13C; U-100% 15N] protein, H2O' 2 H2O # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 700 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2JZ0 _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JZ0 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JZ0 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 Garrett 'data analysis' PIPP ? 2 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 3 'Accelrys Software Inc.' 'structure display' 'Insight II' ? 4 'Cornilescu, Delaglio and Bax' 'dihedral angles prediction' TALOS ? 5 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JZ0 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JZ0 _struct.title DSX_short _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JZ0 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'double sex, sex determination, development, gene regulation, ubiquitin, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 5 ? PHE A 20 ? GLY A 5 PHE A 20 1 ? 16 HELX_P HELX_P2 2 PRO A 23 ? GLU A 25 ? PRO A 23 GLU A 25 5 ? 3 HELX_P HELX_P3 3 LEU A 26 ? ALA A 37 ? LEU A 26 ALA A 37 1 ? 12 HELX_P HELX_P4 4 ASN A 40 ? HIS A 62 ? ASN A 40 HIS A 62 1 ? 23 HELX_P HELX_P5 5 PRO B 3 ? PHE B 20 ? PRO B 3 PHE B 20 1 ? 18 HELX_P HELX_P6 6 PRO B 23 ? GLU B 25 ? PRO B 23 GLU B 25 5 ? 3 HELX_P HELX_P7 7 LEU B 26 ? ALA B 37 ? LEU B 26 ALA B 37 1 ? 12 HELX_P HELX_P8 8 ASN B 40 ? ASN B 63 ? ASN B 40 ASN B 63 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2JZ0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASN 65 65 65 ASN ASN A . n B 1 1 GLY 1 1 1 GLY GLY B . n B 1 2 SER 2 2 2 SER SER B . n B 1 3 PRO 3 3 3 PRO PRO B . n B 1 4 LEU 4 4 4 LEU LEU B . n B 1 5 GLY 5 5 5 GLY GLY B . n B 1 6 GLN 6 6 6 GLN GLN B . n B 1 7 ASP 7 7 7 ASP ASP B . n B 1 8 VAL 8 8 8 VAL VAL B . n B 1 9 PHE 9 9 9 PHE PHE B . n B 1 10 LEU 10 10 10 LEU LEU B . n B 1 11 ASP 11 11 11 ASP ASP B . n B 1 12 TYR 12 12 12 TYR TYR B . n B 1 13 CYS 13 13 13 CYS CYS B . n B 1 14 GLN 14 14 14 GLN GLN B . n B 1 15 LYS 15 15 15 LYS LYS B . n B 1 16 LEU 16 16 16 LEU LEU B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 GLU 18 18 18 GLU GLU B . n B 1 19 LYS 19 19 19 LYS LYS B . n B 1 20 PHE 20 20 20 PHE PHE B . n B 1 21 ARG 21 21 21 ARG ARG B . n B 1 22 TYR 22 22 22 TYR TYR B . n B 1 23 PRO 23 23 23 PRO PRO B . n B 1 24 TRP 24 24 24 TRP TRP B . n B 1 25 GLU 25 25 25 GLU GLU B . n B 1 26 LEU 26 26 26 LEU LEU B . n B 1 27 MET 27 27 27 MET MET B . n B 1 28 PRO 28 28 28 PRO PRO B . n B 1 29 LEU 29 29 29 LEU LEU B . n B 1 30 MET 30 30 30 MET MET B . n B 1 31 TYR 31 31 31 TYR TYR B . n B 1 32 VAL 32 32 32 VAL VAL B . n B 1 33 ILE 33 33 33 ILE ILE B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 LYS 35 35 35 LYS LYS B . n B 1 36 ASP 36 36 36 ASP ASP B . n B 1 37 ALA 37 37 37 ALA ALA B . n B 1 38 ASP 38 38 38 ASP ASP B . n B 1 39 ALA 39 39 39 ALA ALA B . n B 1 40 ASN 40 40 40 ASN ASN B . n B 1 41 ILE 41 41 41 ILE ILE B . n B 1 42 GLU 42 42 42 GLU GLU B . n B 1 43 GLU 43 43 43 GLU GLU B . n B 1 44 ALA 44 44 44 ALA ALA B . n B 1 45 SER 45 45 45 SER SER B . n B 1 46 ARG 46 46 46 ARG ARG B . n B 1 47 ARG 47 47 47 ARG ARG B . n B 1 48 ILE 48 48 48 ILE ILE B . n B 1 49 GLU 49 49 49 GLU GLU B . n B 1 50 GLU 50 50 50 GLU GLU B . n B 1 51 GLY 51 51 51 GLY GLY B . n B 1 52 GLN 52 52 52 GLN GLN B . n B 1 53 TYR 53 53 53 TYR TYR B . n B 1 54 VAL 54 54 54 VAL VAL B . n B 1 55 VAL 55 55 55 VAL VAL B . n B 1 56 ASN 56 56 56 ASN ASN B . n B 1 57 GLU 57 57 57 GLU GLU B . n B 1 58 TYR 58 58 58 TYR TYR B . n B 1 59 SER 59 59 59 SER SER B . n B 1 60 ARG 60 60 60 ARG ARG B . n B 1 61 GLN 61 61 61 GLN GLN B . n B 1 62 HIS 62 62 62 HIS HIS B . n B 1 63 ASN 63 63 63 ASN ASN B . n B 1 64 LEU 64 64 64 LEU LEU B . n B 1 65 ASN 65 65 65 ASN ASN B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-01-08 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id H2O 90 % ? 1 D2O 10 % ? 1 'entity 1' 1 mM '[U-100% 13C; U-100% 15N]' 1 'entity 2' 1 mM '[U-100% 13C; U-100% 15N]' 1 H2O 90 % ? 2 D2O 10 % ? 2 'entity 1' 1 mM '[U-100% 13C; U-100% 15N]' 2 'entity 2' 1.2 mM ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O B GLU 50 ? ? H B VAL 54 ? ? 1.38 2 1 O A GLU 50 ? ? H A VAL 54 ? ? 1.40 3 1 O A ILE 41 ? ? H A SER 45 ? ? 1.42 4 1 O B ILE 41 ? ? H B SER 45 ? ? 1.45 5 1 O B CYS 13 ? ? H B LEU 17 ? ? 1.46 6 1 O B TYR 53 ? ? H B GLU 57 ? ? 1.46 7 1 O A TYR 53 ? ? H A GLU 57 ? ? 1.47 8 1 O A TYR 12 ? ? H A LEU 16 ? ? 1.51 9 1 O B TYR 12 ? ? H B LEU 16 ? ? 1.51 10 1 O A ILE 48 ? ? H A GLN 52 ? ? 1.56 11 1 O B ILE 48 ? ? H B GLN 52 ? ? 1.57 12 1 O B LYS 15 ? ? H B LYS 19 ? ? 1.57 13 2 O B GLU 50 ? ? H B VAL 54 ? ? 1.39 14 2 O A GLU 50 ? ? H A VAL 54 ? ? 1.39 15 2 O A ILE 41 ? ? H A SER 45 ? ? 1.43 16 2 O B ILE 41 ? ? H B SER 45 ? ? 1.45 17 2 O A TYR 12 ? ? H A LEU 16 ? ? 1.45 18 2 O B LYS 15 ? ? H B LYS 19 ? ? 1.45 19 2 O A CYS 13 ? ? H A LEU 17 ? ? 1.46 20 2 O B CYS 13 ? ? H B LEU 17 ? ? 1.47 21 2 O B TYR 53 ? ? H B GLU 57 ? ? 1.47 22 2 O A TYR 53 ? ? H A GLU 57 ? ? 1.49 23 2 O A LYS 15 ? ? H A LYS 19 ? ? 1.53 24 2 O A ILE 48 ? ? H A GLN 52 ? ? 1.54 25 2 O A ASP 7 ? ? H A ASP 11 ? ? 1.55 26 2 O B ILE 48 ? ? H B GLN 52 ? ? 1.57 27 2 O B ASN 40 ? ? H B ALA 44 ? ? 1.58 28 3 O B GLU 50 ? ? H B VAL 54 ? ? 1.38 29 3 O A GLU 50 ? ? H A VAL 54 ? ? 1.39 30 3 O A ILE 41 ? ? H A SER 45 ? ? 1.43 31 3 O A LYS 15 ? ? H A LYS 19 ? ? 1.44 32 3 O B ILE 41 ? ? H B SER 45 ? ? 1.45 33 3 O B TYR 12 ? ? H B LEU 16 ? ? 1.46 34 3 O A TYR 53 ? ? H A GLU 57 ? ? 1.46 35 3 HH A TYR 53 ? ? OE2 A GLU 57 ? ? 1.47 36 3 O B CYS 13 ? ? H B LEU 17 ? ? 1.49 37 3 O B LYS 15 ? ? H B LYS 19 ? ? 1.55 38 3 O B ILE 48 ? ? H B GLN 52 ? ? 1.55 39 3 O A ILE 48 ? ? H A GLN 52 ? ? 1.56 40 3 O A GLU 57 ? ? H A ARG 60 ? ? 1.57 41 3 O B ASP 7 ? ? H B ASP 11 ? ? 1.60 42 4 O A GLU 50 ? ? H A VAL 54 ? ? 1.39 43 4 O B GLU 50 ? ? H B VAL 54 ? ? 1.40 44 4 O A LYS 15 ? ? H A LYS 19 ? ? 1.42 45 4 O A ILE 41 ? ? H A SER 45 ? ? 1.45 46 4 O B ILE 41 ? ? H B SER 45 ? ? 1.45 47 4 O B CYS 13 ? ? H B LEU 17 ? ? 1.46 48 4 O A TYR 53 ? ? H A GLU 57 ? ? 1.47 49 4 O B TYR 12 ? ? H B LEU 16 ? ? 1.48 50 4 O A ASN 40 ? ? H A ALA 44 ? ? 1.52 51 4 O A CYS 13 ? ? H A LEU 17 ? ? 1.52 52 4 O B LYS 15 ? ? H B LYS 19 ? ? 1.54 53 4 O A ILE 48 ? ? H A GLN 52 ? ? 1.55 54 4 O B ASN 40 ? ? H B ALA 44 ? ? 1.56 55 4 O A TYR 12 ? ? H A LEU 16 ? ? 1.56 56 4 O A ASP 7 ? ? H A ASP 11 ? ? 1.57 57 4 OE2 B GLU 43 ? ? HH21 B ARG 46 ? ? 1.57 58 4 O B ILE 48 ? ? H B GLN 52 ? ? 1.59 59 5 O B GLU 50 ? ? H B VAL 54 ? ? 1.37 60 5 O A GLU 50 ? ? H A VAL 54 ? ? 1.39 61 5 O B LYS 15 ? ? H B LYS 19 ? ? 1.44 62 5 O A LYS 15 ? ? H A LYS 19 ? ? 1.44 63 5 O B ILE 41 ? ? H B SER 45 ? ? 1.44 64 5 O A ILE 41 ? ? H A SER 45 ? ? 1.44 65 5 O A CYS 13 ? ? H A LEU 17 ? ? 1.47 66 5 O A ASP 7 ? ? H A ASP 11 ? ? 1.52 67 5 O A ASN 40 ? ? H A ALA 44 ? ? 1.53 68 5 O B GLN 14 ? ? H B GLU 18 ? ? 1.54 69 5 O B ILE 48 ? ? H B GLN 52 ? ? 1.54 70 5 O A ILE 48 ? ? H A GLN 52 ? ? 1.55 71 5 O B TYR 12 ? ? H B LEU 16 ? ? 1.59 72 6 O B GLU 50 ? ? H B VAL 54 ? ? 1.36 73 6 O A GLU 50 ? ? H A VAL 54 ? ? 1.39 74 6 O A ILE 41 ? ? H A SER 45 ? ? 1.41 75 6 O B CYS 13 ? ? H B LEU 17 ? ? 1.45 76 6 O A TYR 53 ? ? H A GLU 57 ? ? 1.45 77 6 O B ILE 41 ? ? H B SER 45 ? ? 1.45 78 6 O A TYR 12 ? ? H A LEU 16 ? ? 1.45 79 6 O A CYS 13 ? ? H A LEU 17 ? ? 1.48 80 6 O A ASP 7 ? ? H A ASP 11 ? ? 1.48 81 6 O B LYS 15 ? ? H B LYS 19 ? ? 1.49 82 6 O A ILE 48 ? ? H A GLN 52 ? ? 1.53 83 6 O A LYS 15 ? ? H A LYS 19 ? ? 1.54 84 6 O B ILE 48 ? ? H B GLN 52 ? ? 1.56 85 6 O B ASN 40 ? ? H B ALA 44 ? ? 1.58 86 6 O B TYR 12 ? ? H B LEU 16 ? ? 1.58 87 7 O B GLU 50 ? ? H B VAL 54 ? ? 1.37 88 7 O A GLU 50 ? ? H A VAL 54 ? ? 1.41 89 7 O B ILE 41 ? ? H B SER 45 ? ? 1.43 90 7 O B CYS 13 ? ? H B LEU 17 ? ? 1.44 91 7 O A ILE 41 ? ? H A SER 45 ? ? 1.44 92 7 O A CYS 13 ? ? H A LEU 17 ? ? 1.44 93 7 O B LYS 15 ? ? H B LYS 19 ? ? 1.48 94 7 O A LYS 15 ? ? H A LYS 19 ? ? 1.50 95 7 O A TYR 53 ? ? H A GLU 57 ? ? 1.50 96 7 O A ASP 7 ? ? H A ASP 11 ? ? 1.54 97 7 O B ILE 48 ? ? H B GLN 52 ? ? 1.56 98 7 O A ILE 48 ? ? H A GLN 52 ? ? 1.57 99 7 O B GLU 42 ? ? HE B ARG 46 ? ? 1.58 100 8 O B GLU 50 ? ? H B VAL 54 ? ? 1.38 101 8 O A GLU 50 ? ? H A VAL 54 ? ? 1.39 102 8 O B ILE 41 ? ? H B SER 45 ? ? 1.42 103 8 O A ILE 41 ? ? H A SER 45 ? ? 1.43 104 8 O B TYR 53 ? ? H B GLU 57 ? ? 1.45 105 8 O B CYS 13 ? ? H B LEU 17 ? ? 1.45 106 8 O B LYS 15 ? ? H B LYS 19 ? ? 1.45 107 8 O A LYS 15 ? ? H A LYS 19 ? ? 1.46 108 8 O A CYS 13 ? ? H A LEU 17 ? ? 1.49 109 8 O B SER 2 ? ? H B LEU 4 ? ? 1.51 110 8 O B PRO 3 ? ? H B GLY 5 ? ? 1.54 111 8 O A ILE 48 ? ? H A GLN 52 ? ? 1.56 112 8 O B ASP 7 ? ? H B ASP 11 ? ? 1.59 113 8 O B ILE 48 ? ? H B GLN 52 ? ? 1.59 114 8 O A TYR 53 ? ? H A GLU 57 ? ? 1.59 115 9 O A GLU 50 ? ? H A VAL 54 ? ? 1.37 116 9 O B GLU 50 ? ? H B VAL 54 ? ? 1.38 117 9 O B ILE 41 ? ? H B SER 45 ? ? 1.43 118 9 O A ILE 41 ? ? H A SER 45 ? ? 1.44 119 9 O A TYR 53 ? ? H A GLU 57 ? ? 1.45 120 9 O B LYS 15 ? ? H B LYS 19 ? ? 1.46 121 9 O B TYR 53 ? ? H B GLU 57 ? ? 1.47 122 9 O A TYR 12 ? ? H A LEU 16 ? ? 1.48 123 9 O A ASN 40 ? ? H A ALA 44 ? ? 1.49 124 9 O A CYS 13 ? ? H A LEU 17 ? ? 1.51 125 9 O A ILE 48 ? ? H A GLN 52 ? ? 1.51 126 9 O B PRO 3 ? ? H B GLY 5 ? ? 1.53 127 9 O A LYS 15 ? ? H A LYS 19 ? ? 1.53 128 9 O B SER 2 ? ? H B LEU 4 ? ? 1.55 129 9 O A PRO 3 ? ? H A GLY 5 ? ? 1.56 130 9 O B ILE 48 ? ? H B GLN 52 ? ? 1.57 131 9 O A ARG 47 ? ? H A GLY 51 ? ? 1.59 132 10 O B GLU 50 ? ? H B VAL 54 ? ? 1.38 133 10 O A GLU 50 ? ? H A VAL 54 ? ? 1.40 134 10 O A ILE 41 ? ? H A SER 45 ? ? 1.41 135 10 O B ILE 41 ? ? H B SER 45 ? ? 1.45 136 10 O A TYR 12 ? ? H A LEU 16 ? ? 1.47 137 10 O B TYR 12 ? ? H B LEU 16 ? ? 1.47 138 10 O A TYR 53 ? ? H A GLU 57 ? ? 1.48 139 10 O B CYS 13 ? ? H B LEU 17 ? ? 1.49 140 10 O B TYR 53 ? ? H B GLU 57 ? ? 1.49 141 10 O B LYS 15 ? ? H B LYS 19 ? ? 1.50 142 10 O B ASN 40 ? ? H B ALA 44 ? ? 1.51 143 10 O A LYS 15 ? ? H A LYS 19 ? ? 1.53 144 10 O A ILE 48 ? ? H A GLN 52 ? ? 1.54 145 10 O A CYS 13 ? ? H A LEU 17 ? ? 1.55 146 10 O B ILE 48 ? ? H B GLN 52 ? ? 1.56 147 10 O B ASP 7 ? ? H B ASP 11 ? ? 1.58 148 10 O A GLU 57 ? ? H A ARG 60 ? ? 1.58 149 10 O A ASP 7 ? ? H A ASP 11 ? ? 1.59 150 11 O B GLU 50 ? ? H B VAL 54 ? ? 1.36 151 11 O A GLU 50 ? ? H A VAL 54 ? ? 1.38 152 11 O B ILE 41 ? ? H B SER 45 ? ? 1.45 153 11 O A CYS 13 ? ? H A LEU 17 ? ? 1.45 154 11 O A TYR 53 ? ? H A GLU 57 ? ? 1.46 155 11 O B CYS 13 ? ? H B LEU 17 ? ? 1.46 156 11 O A LYS 15 ? ? H A LYS 19 ? ? 1.46 157 11 O B TYR 12 ? ? H B LEU 16 ? ? 1.47 158 11 O A ILE 41 ? ? H A SER 45 ? ? 1.48 159 11 OD1 B ASN 40 ? ? H B GLU 43 ? ? 1.49 160 11 O B ASN 40 ? ? H B ALA 44 ? ? 1.53 161 11 O B LYS 15 ? ? H B LYS 19 ? ? 1.54 162 11 O A ILE 48 ? ? H A GLN 52 ? ? 1.55 163 11 OE2 A GLU 43 ? ? HH21 A ARG 46 ? ? 1.56 164 11 O B TYR 53 ? ? H B GLU 57 ? ? 1.56 165 11 O B ILE 48 ? ? H B GLN 52 ? ? 1.56 166 12 O B GLU 50 ? ? H B VAL 54 ? ? 1.38 167 12 O A GLU 50 ? ? H A VAL 54 ? ? 1.39 168 12 O A CYS 13 ? ? H A LEU 17 ? ? 1.43 169 12 O A ILE 41 ? ? H A SER 45 ? ? 1.43 170 12 O B ILE 41 ? ? H B SER 45 ? ? 1.45 171 12 O B TYR 53 ? ? H B GLU 57 ? ? 1.46 172 12 O B LYS 15 ? ? H B LYS 19 ? ? 1.46 173 12 O A TYR 12 ? ? H A LEU 16 ? ? 1.46 174 12 O B CYS 13 ? ? H B LEU 17 ? ? 1.47 175 12 O A ASP 7 ? ? H A ASP 11 ? ? 1.51 176 12 O B PRO 3 ? ? H B GLY 5 ? ? 1.52 177 12 O B ASN 40 ? ? H B ALA 44 ? ? 1.53 178 12 O A LYS 15 ? ? H A LYS 19 ? ? 1.54 179 12 O A ILE 48 ? ? H A GLN 52 ? ? 1.55 180 12 O B SER 59 ? ? H B LEU 64 ? ? 1.59 181 12 O B ILE 48 ? ? H B GLN 52 ? ? 1.60 182 13 O B GLU 50 ? ? H B VAL 54 ? ? 1.36 183 13 O A GLU 50 ? ? H A VAL 54 ? ? 1.37 184 13 O A ILE 41 ? ? H A SER 45 ? ? 1.44 185 13 O A CYS 13 ? ? H A LEU 17 ? ? 1.46 186 13 O A TYR 12 ? ? H A LEU 16 ? ? 1.46 187 13 O B ILE 41 ? ? H B SER 45 ? ? 1.46 188 13 O B ASN 40 ? ? H B ALA 44 ? ? 1.47 189 13 O B CYS 13 ? ? H B LEU 17 ? ? 1.48 190 13 O A ASN 40 ? ? H A ALA 44 ? ? 1.48 191 13 O B LYS 15 ? ? H B LYS 19 ? ? 1.50 192 13 O A ILE 48 ? ? H A GLN 52 ? ? 1.53 193 13 O A LYS 15 ? ? H A LYS 19 ? ? 1.54 194 13 O A ASP 7 ? ? H A ASP 11 ? ? 1.55 195 13 O B ILE 48 ? ? H B GLN 52 ? ? 1.57 196 13 O A LEU 4 ? ? H A VAL 8 ? ? 1.59 197 13 O B TYR 12 ? ? H B LEU 16 ? ? 1.59 198 13 O B GLY 51 ? ? H B VAL 55 ? ? 1.59 199 14 O B GLU 50 ? ? H B VAL 54 ? ? 1.37 200 14 O A GLU 50 ? ? H A VAL 54 ? ? 1.39 201 14 O B ILE 41 ? ? H B SER 45 ? ? 1.44 202 14 O B TYR 53 ? ? H B GLU 57 ? ? 1.45 203 14 O A ILE 41 ? ? H A SER 45 ? ? 1.45 204 14 O A TYR 53 ? ? H A GLU 57 ? ? 1.46 205 14 O A TYR 12 ? ? H A LEU 16 ? ? 1.46 206 14 O B CYS 13 ? ? H B LEU 17 ? ? 1.46 207 14 O B TYR 12 ? ? H B LEU 16 ? ? 1.47 208 14 O A CYS 13 ? ? H A LEU 17 ? ? 1.47 209 14 O A ASN 40 ? ? H A ALA 44 ? ? 1.49 210 14 O A ILE 48 ? ? H A GLN 52 ? ? 1.53 211 14 O B PRO 3 ? ? H B GLY 5 ? ? 1.54 212 14 O B LYS 15 ? ? H B LYS 19 ? ? 1.56 213 14 O A LYS 15 ? ? H A LYS 19 ? ? 1.57 214 14 O B ASN 40 ? ? H B ALA 44 ? ? 1.57 215 14 O B SER 2 ? ? H B LEU 4 ? ? 1.59 216 14 O B ILE 48 ? ? H B GLN 52 ? ? 1.59 217 15 O B GLU 50 ? ? H B VAL 54 ? ? 1.38 218 15 O A GLU 50 ? ? H A VAL 54 ? ? 1.38 219 15 O A ILE 41 ? ? H A SER 45 ? ? 1.42 220 15 O B ILE 41 ? ? H B SER 45 ? ? 1.43 221 15 O B TYR 12 ? ? H B LEU 16 ? ? 1.47 222 15 O B TYR 53 ? ? H B GLU 57 ? ? 1.47 223 15 O B CYS 13 ? ? H B LEU 17 ? ? 1.48 224 15 O B ASP 7 ? ? H B ASP 11 ? ? 1.48 225 15 O B LYS 15 ? ? H B LYS 19 ? ? 1.55 226 15 O A ILE 48 ? ? H A GLN 52 ? ? 1.55 227 15 O A TYR 53 ? ? H A GLU 57 ? ? 1.55 228 15 O B ILE 48 ? ? H B GLN 52 ? ? 1.57 229 16 O B GLU 50 ? ? H B VAL 54 ? ? 1.38 230 16 O A GLU 50 ? ? H A VAL 54 ? ? 1.39 231 16 O A LYS 15 ? ? H A LYS 19 ? ? 1.44 232 16 O A ILE 41 ? ? H A SER 45 ? ? 1.44 233 16 O B ILE 41 ? ? H B SER 45 ? ? 1.44 234 16 O B CYS 13 ? ? H B LEU 17 ? ? 1.45 235 16 O B TYR 53 ? ? H B GLU 57 ? ? 1.47 236 16 O B TYR 12 ? ? H B LEU 16 ? ? 1.48 237 16 O A ASP 7 ? ? H A ASP 11 ? ? 1.53 238 16 O A ILE 48 ? ? H A GLN 52 ? ? 1.53 239 16 O B LYS 15 ? ? H B LYS 19 ? ? 1.53 240 16 O A TYR 12 ? ? H A LEU 16 ? ? 1.56 241 16 O B ILE 48 ? ? H B GLN 52 ? ? 1.57 242 17 O B GLU 50 ? ? H B VAL 54 ? ? 1.38 243 17 O A GLU 50 ? ? H A VAL 54 ? ? 1.39 244 17 O A ILE 41 ? ? H A SER 45 ? ? 1.43 245 17 O B ILE 41 ? ? H B SER 45 ? ? 1.43 246 17 O B CYS 13 ? ? H B LEU 17 ? ? 1.43 247 17 O A CYS 13 ? ? H A LEU 17 ? ? 1.46 248 17 O B TYR 12 ? ? H B LEU 16 ? ? 1.47 249 17 O B TYR 53 ? ? H B GLU 57 ? ? 1.48 250 17 O A LYS 15 ? ? H A LYS 19 ? ? 1.49 251 17 O A TYR 53 ? ? H A GLU 57 ? ? 1.54 252 17 O B LYS 15 ? ? H B LYS 19 ? ? 1.55 253 17 O A ASN 40 ? ? H A ALA 44 ? ? 1.57 254 17 O A ILE 48 ? ? H A GLN 52 ? ? 1.57 255 17 O B ILE 48 ? ? H B GLN 52 ? ? 1.57 256 17 O B ASN 40 ? ? H B ALA 44 ? ? 1.58 257 17 O A ASP 7 ? ? H A ASP 11 ? ? 1.58 258 17 O A GLU 57 ? ? H A ARG 60 ? ? 1.59 259 17 O A TYR 12 ? ? H A LEU 16 ? ? 1.59 260 18 O B GLU 50 ? ? H B VAL 54 ? ? 1.38 261 18 O A GLU 50 ? ? H A VAL 54 ? ? 1.39 262 18 O A ILE 41 ? ? H A SER 45 ? ? 1.41 263 18 O B ILE 41 ? ? H B SER 45 ? ? 1.44 264 18 O A CYS 13 ? ? H A LEU 17 ? ? 1.45 265 18 O A TYR 53 ? ? H A GLU 57 ? ? 1.45 266 18 O B CYS 13 ? ? H B LEU 17 ? ? 1.47 267 18 O B TYR 12 ? ? H B LEU 16 ? ? 1.48 268 18 O A LYS 15 ? ? H A LYS 19 ? ? 1.49 269 18 O B ASN 40 ? ? H B ALA 44 ? ? 1.52 270 18 O A ILE 48 ? ? H A GLN 52 ? ? 1.54 271 18 O B ILE 48 ? ? H B GLN 52 ? ? 1.54 272 18 O B LYS 15 ? ? H B LYS 19 ? ? 1.54 273 18 O A TYR 12 ? ? H A LEU 16 ? ? 1.58 274 19 HH A TYR 58 ? ? HE2 A HIS 62 ? ? 1.32 275 19 O A GLU 50 ? ? H A VAL 54 ? ? 1.37 276 19 O B GLU 50 ? ? H B VAL 54 ? ? 1.38 277 19 O B LYS 15 ? ? H B LYS 19 ? ? 1.44 278 19 O A ILE 41 ? ? H A SER 45 ? ? 1.45 279 19 O B ILE 41 ? ? H B SER 45 ? ? 1.45 280 19 O A LYS 15 ? ? H A LYS 19 ? ? 1.46 281 19 O A CYS 13 ? ? H A LEU 17 ? ? 1.47 282 19 O B TYR 53 ? ? H B GLU 57 ? ? 1.49 283 19 O A PRO 3 ? ? H A GLY 5 ? ? 1.50 284 19 O A ASN 40 ? ? H A ALA 44 ? ? 1.54 285 19 O B ILE 48 ? ? H B GLN 52 ? ? 1.55 286 19 O B ASP 7 ? ? H B ASP 11 ? ? 1.56 287 19 O A TYR 53 ? ? H A GLU 57 ? ? 1.56 288 19 O B ASN 40 ? ? H B ALA 44 ? ? 1.56 289 19 O A ILE 48 ? ? H A GLN 52 ? ? 1.56 290 19 O A GLU 57 ? ? H A ARG 60 ? ? 1.58 291 20 O B GLU 50 ? ? H B VAL 54 ? ? 1.37 292 20 O A GLU 50 ? ? H A VAL 54 ? ? 1.39 293 20 O A LYS 15 ? ? H A LYS 19 ? ? 1.43 294 20 O B CYS 13 ? ? H B LEU 17 ? ? 1.44 295 20 O A ILE 41 ? ? H A SER 45 ? ? 1.45 296 20 O B ILE 41 ? ? H B SER 45 ? ? 1.46 297 20 O B LYS 15 ? ? H B LYS 19 ? ? 1.47 298 20 O A ASP 7 ? ? H A ASP 11 ? ? 1.52 299 20 O A ILE 48 ? ? H A GLN 52 ? ? 1.54 300 20 O A ASN 40 ? ? H A ALA 44 ? ? 1.54 301 20 O A TYR 53 ? ? H A GLU 57 ? ? 1.55 302 20 O A GLU 57 ? ? H A ARG 60 ? ? 1.55 303 20 O B ILE 48 ? ? H B GLN 52 ? ? 1.56 304 20 O B TYR 53 ? ? H B GLU 57 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 3 ? ? -76.30 -148.36 2 1 PRO A 23 ? ? -56.07 175.59 3 1 ALA A 37 ? ? -83.09 34.62 4 1 ASP A 38 ? ? 55.60 12.18 5 1 ASN A 63 ? ? 58.98 82.36 6 1 SER B 2 ? ? -157.94 72.68 7 1 PRO B 3 ? ? -78.09 -146.29 8 1 PRO B 23 ? ? -55.19 176.34 9 1 ALA B 37 ? ? -78.24 35.07 10 1 ASP B 38 ? ? 52.76 15.24 11 1 ASN B 63 ? ? 51.76 7.12 12 2 PRO A 3 ? ? -76.88 -145.47 13 2 PRO A 23 ? ? -55.04 176.12 14 2 ALA A 37 ? ? -83.24 35.86 15 2 ASP A 38 ? ? 55.09 13.19 16 2 TYR A 58 ? ? -48.88 -19.67 17 2 ASN A 63 ? ? 57.60 3.31 18 2 LEU A 64 ? ? 44.78 -88.78 19 2 SER B 2 ? ? -155.54 71.46 20 2 PRO B 3 ? ? -70.19 -145.24 21 2 PRO B 23 ? ? -55.55 175.93 22 2 ALA B 37 ? ? -80.96 36.36 23 2 ASP B 38 ? ? 55.53 16.13 24 2 ASN B 63 ? ? 55.97 72.18 25 3 PRO A 3 ? ? -80.37 -146.18 26 3 PRO A 23 ? ? -56.23 176.13 27 3 ALA A 37 ? ? -81.17 34.25 28 3 ASP A 38 ? ? 55.35 11.79 29 3 ASN A 63 ? ? 57.42 4.07 30 3 LEU A 64 ? ? 43.47 -136.20 31 3 PRO B 3 ? ? -75.43 -144.78 32 3 PRO B 23 ? ? -55.35 176.19 33 3 ALA B 37 ? ? -85.41 36.11 34 3 ASP B 38 ? ? 54.96 13.59 35 3 ASN B 63 ? ? 64.72 69.18 36 3 LEU B 64 ? ? -101.23 -74.02 37 4 PRO A 3 ? ? -76.66 -145.30 38 4 PRO A 23 ? ? -55.39 175.62 39 4 ALA A 37 ? ? -81.19 36.22 40 4 ASP A 38 ? ? 55.47 9.58 41 4 ASN A 63 ? ? 82.25 -76.76 42 4 SER B 2 ? ? 177.46 -46.41 43 4 PRO B 3 ? ? -76.50 -144.91 44 4 PRO B 23 ? ? -55.22 175.55 45 4 ALA B 37 ? ? -80.23 36.35 46 4 ASP B 38 ? ? 54.15 18.40 47 4 ASN B 63 ? ? 57.26 76.39 48 4 LEU B 64 ? ? -114.08 -74.06 49 5 SER A 2 ? ? -174.11 73.16 50 5 PRO A 3 ? ? -74.70 -147.32 51 5 PRO A 23 ? ? -55.69 176.08 52 5 ALA A 37 ? ? -81.13 36.16 53 5 ASP A 38 ? ? 55.76 10.21 54 5 ASN A 63 ? ? 52.40 7.52 55 5 LEU A 64 ? ? 41.62 -135.53 56 5 SER B 2 ? ? -156.69 72.84 57 5 PRO B 3 ? ? -76.97 -145.72 58 5 PRO B 23 ? ? -55.42 176.31 59 5 ALA B 37 ? ? -82.70 36.35 60 5 ASP B 38 ? ? 55.56 12.89 61 5 ASN B 63 ? ? 60.94 74.13 62 6 SER A 2 ? ? -158.86 72.21 63 6 PRO A 3 ? ? -71.90 -144.61 64 6 PRO A 23 ? ? -57.40 175.41 65 6 ALA A 37 ? ? -96.26 35.16 66 6 ASP A 38 ? ? 54.53 15.87 67 6 ASN A 63 ? ? 60.03 76.12 68 6 SER B 2 ? ? -160.27 72.56 69 6 PRO B 3 ? ? -75.77 -146.14 70 6 PRO B 23 ? ? -56.06 176.39 71 6 ALA B 37 ? ? -78.66 35.15 72 6 ASP B 38 ? ? 55.17 15.58 73 6 ASN B 63 ? ? 159.92 -95.67 74 7 PRO A 3 ? ? -72.85 -143.42 75 7 PRO A 23 ? ? -56.55 175.85 76 7 ALA A 37 ? ? -78.58 36.39 77 7 ASP A 38 ? ? 55.25 12.93 78 7 ASN A 63 ? ? 65.27 99.39 79 7 LEU A 64 ? ? 168.63 179.04 80 7 SER B 2 ? ? -179.42 -47.12 81 7 PRO B 3 ? ? -80.22 -149.20 82 7 PRO B 23 ? ? -53.35 175.83 83 7 ALA B 37 ? ? -78.49 36.32 84 7 ASN B 63 ? ? 55.47 78.06 85 7 LEU B 64 ? ? -116.55 68.90 86 8 SER A 2 ? ? 178.03 -46.72 87 8 PRO A 3 ? ? -77.31 -145.69 88 8 PRO A 23 ? ? -56.89 176.06 89 8 ALA A 37 ? ? -81.82 36.32 90 8 ASP A 38 ? ? 54.27 12.97 91 8 ASN A 63 ? ? 54.74 6.05 92 8 SER B 2 ? ? 178.81 -47.03 93 8 PRO B 3 ? ? -69.02 55.29 94 8 LEU B 4 ? ? 63.93 -34.93 95 8 PRO B 23 ? ? -56.87 175.06 96 8 ALA B 37 ? ? -82.30 36.07 97 8 ASP B 38 ? ? 54.12 13.64 98 8 ASN B 63 ? ? 59.46 81.03 99 9 LEU A 4 ? ? 52.98 -16.38 100 9 PRO A 23 ? ? -55.50 175.96 101 9 ALA A 37 ? ? -79.33 36.01 102 9 ASP A 38 ? ? 53.65 17.11 103 9 ASN A 63 ? ? 64.02 77.44 104 9 LEU A 64 ? ? 174.20 161.66 105 9 SER B 2 ? ? 49.74 72.77 106 9 PRO B 3 ? ? -69.36 56.21 107 9 LEU B 4 ? ? 64.28 -35.20 108 9 PRO B 23 ? ? -56.91 175.34 109 9 ALA B 37 ? ? -79.10 35.97 110 9 ASP B 38 ? ? 54.38 13.52 111 9 ASN B 63 ? ? 81.02 -77.22 112 9 LEU B 64 ? ? 44.95 89.07 113 10 SER A 2 ? ? -160.57 73.01 114 10 PRO A 3 ? ? -76.52 -146.94 115 10 PRO A 23 ? ? -55.50 176.13 116 10 ALA A 37 ? ? -85.77 35.30 117 10 ASP A 38 ? ? 54.82 13.38 118 10 ASN A 63 ? ? 56.93 79.30 119 10 PRO B 3 ? ? -72.27 -144.20 120 10 PRO B 23 ? ? -55.66 176.17 121 10 ALA B 37 ? ? -82.02 36.34 122 10 ASP B 38 ? ? 54.59 15.44 123 10 ASN B 63 ? ? 60.88 64.00 124 11 SER A 2 ? ? -178.14 -45.93 125 11 LEU A 4 ? ? 63.53 -28.42 126 11 PRO A 23 ? ? -55.46 175.22 127 11 ALA A 37 ? ? -79.09 36.26 128 11 ASP A 38 ? ? 55.66 10.98 129 11 GLN A 61 ? ? -55.22 -9.09 130 11 ASN A 63 ? ? 57.16 6.46 131 11 LEU A 64 ? ? 43.49 -88.46 132 11 SER B 2 ? ? -169.71 72.89 133 11 PRO B 3 ? ? -75.71 -146.18 134 11 PRO B 23 ? ? -54.59 175.62 135 11 ALA B 37 ? ? -80.09 34.04 136 11 ASP B 38 ? ? 55.57 15.17 137 11 ASN B 63 ? ? 53.18 77.19 138 11 LEU B 64 ? ? -113.35 -127.35 139 12 SER A 2 ? ? 177.10 -46.83 140 12 PRO A 3 ? ? -75.33 -145.85 141 12 PRO A 23 ? ? -55.85 175.61 142 12 ALA A 37 ? ? -79.74 36.00 143 12 ASP A 38 ? ? 54.47 12.84 144 12 ASN A 63 ? ? 64.55 95.02 145 12 LEU A 64 ? ? 170.02 170.69 146 12 SER B 2 ? ? -150.94 73.27 147 12 PRO B 3 ? ? -68.41 64.36 148 12 LEU B 4 ? ? 63.75 -34.47 149 12 PRO B 23 ? ? -55.97 175.87 150 12 ALA B 37 ? ? -79.68 36.22 151 12 ASP B 38 ? ? 54.66 14.56 152 12 ASN B 63 ? ? 62.00 71.24 153 12 LEU B 64 ? ? -117.91 73.37 154 13 PRO A 3 ? ? -72.08 -151.83 155 13 PRO A 23 ? ? -55.42 176.03 156 13 ALA A 37 ? ? -81.66 35.91 157 13 ASP A 38 ? ? 53.32 16.94 158 13 TYR A 58 ? ? -49.37 -17.80 159 13 ASN A 63 ? ? 57.18 84.45 160 13 LEU A 64 ? ? -115.04 -126.22 161 13 PRO B 3 ? ? -76.38 -143.38 162 13 PRO B 23 ? ? -55.66 174.82 163 13 ALA B 37 ? ? -90.14 35.47 164 13 ASP B 38 ? ? 54.76 13.57 165 13 ASN B 63 ? ? 59.72 75.07 166 13 LEU B 64 ? ? -115.23 -124.56 167 14 SER A 2 ? ? -32.35 97.62 168 14 PRO A 3 ? ? -75.20 -146.47 169 14 PRO A 23 ? ? -54.67 176.05 170 14 ALA A 37 ? ? -78.05 36.20 171 14 ASP A 38 ? ? 53.56 16.52 172 14 ASN A 63 ? ? 159.03 -86.83 173 14 LEU A 64 ? ? 38.44 -119.68 174 14 LEU B 4 ? ? 63.73 -33.78 175 14 PRO B 23 ? ? -56.02 175.80 176 14 ALA B 37 ? ? -79.06 36.03 177 14 ASP B 38 ? ? 53.57 14.88 178 14 ASN B 63 ? ? 61.84 132.70 179 14 LEU B 64 ? ? -127.80 -66.38 180 15 PRO A 3 ? ? -70.70 -148.04 181 15 PRO A 23 ? ? -57.97 175.16 182 15 ALA A 37 ? ? -85.62 33.22 183 15 ASP A 38 ? ? 55.12 11.84 184 15 LEU A 64 ? ? -99.95 -124.33 185 15 SER B 2 ? ? 178.31 -45.66 186 15 PRO B 3 ? ? -78.40 -147.94 187 15 PRO B 23 ? ? -55.01 175.29 188 15 ALA B 37 ? ? -83.88 36.66 189 15 ASP B 38 ? ? 54.77 16.10 190 15 ASN B 63 ? ? 58.00 4.55 191 15 LEU B 64 ? ? -24.98 -38.08 192 16 SER A 2 ? ? -154.33 72.21 193 16 PRO A 3 ? ? -75.97 -92.15 194 16 PRO A 23 ? ? -55.15 176.13 195 16 ALA A 37 ? ? -83.34 36.42 196 16 ASP A 38 ? ? 54.55 16.49 197 16 ASN A 63 ? ? 55.16 6.55 198 16 LEU A 64 ? ? 41.37 -137.39 199 16 PRO B 3 ? ? -81.70 -146.37 200 16 PRO B 23 ? ? -56.60 175.92 201 16 ALA B 37 ? ? -89.67 36.00 202 16 ASP B 38 ? ? 53.64 16.59 203 16 ASN B 63 ? ? 158.52 -21.06 204 16 LEU B 64 ? ? -45.17 91.81 205 17 PRO A 3 ? ? -78.15 -148.96 206 17 PRO A 23 ? ? -57.15 176.02 207 17 ALA A 37 ? ? -79.88 36.24 208 17 ASP A 38 ? ? 54.43 14.01 209 17 ASN A 63 ? ? 44.49 14.84 210 17 LEU A 64 ? ? 37.38 -128.96 211 17 PRO B 3 ? ? -72.18 -149.82 212 17 PRO B 23 ? ? -54.45 175.50 213 17 ALA B 37 ? ? -83.39 34.41 214 17 ASP B 38 ? ? 54.95 13.43 215 17 ASN B 63 ? ? 57.99 77.53 216 18 PRO A 3 ? ? -83.36 -149.64 217 18 PRO A 23 ? ? -55.73 175.58 218 18 ALA A 37 ? ? -79.97 35.17 219 18 ASP A 38 ? ? 55.32 11.71 220 18 LEU A 64 ? ? -38.87 160.60 221 18 SER B 2 ? ? -167.90 72.40 222 18 PRO B 3 ? ? -73.95 -145.27 223 18 PRO B 23 ? ? -55.68 176.18 224 18 ALA B 37 ? ? -80.15 36.07 225 18 ASP B 38 ? ? 53.87 19.88 226 18 ASN B 63 ? ? 53.23 8.95 227 18 LEU B 64 ? ? 42.87 -122.83 228 19 LEU A 4 ? ? 58.72 -25.45 229 19 PRO A 23 ? ? -55.03 175.87 230 19 ALA A 37 ? ? -80.91 36.22 231 19 ASP A 38 ? ? 53.94 13.84 232 19 ASN A 63 ? ? 56.99 72.96 233 19 PRO B 3 ? ? -79.18 -146.28 234 19 PRO B 23 ? ? -56.38 176.13 235 19 ALA B 37 ? ? -80.16 36.29 236 19 ASP B 38 ? ? 55.33 13.88 237 20 SER A 2 ? ? -38.48 102.85 238 20 PRO A 3 ? ? -73.48 -147.03 239 20 PRO A 23 ? ? -55.29 176.00 240 20 ALA A 37 ? ? -78.10 36.70 241 20 ASP A 38 ? ? 55.29 11.86 242 20 ASN A 63 ? ? 55.26 78.60 243 20 SER B 2 ? ? -169.07 72.72 244 20 PRO B 3 ? ? -76.84 -146.76 245 20 PRO B 23 ? ? -55.67 176.05 246 20 ALA B 37 ? ? -79.18 36.49 247 20 ASP B 38 ? ? 54.95 15.73 248 20 ASN B 63 ? ? 61.93 127.55 #