data_2JZL # _entry.id 2JZL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JZL pdb_00002jzl 10.2210/pdb2jzl/pdb RCSB RCSB100488 ? ? WWPDB D_1000100488 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2JZJ . unspecified PDB 2JZK . unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JZL _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-01-09 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Koharudin, L.M.I.' 1 'Viscomi, A.R.' 2 'Jee, J.' 3 'Ottonello, S.' 4 'Gronenborn, A.M.' 5 # _citation.id primary _citation.title 'The evolutionarily conserved family of cyanovirin-N homologs: structures and carbohydrate specificity.' _citation.journal_abbrev Structure _citation.journal_volume 16 _citation.page_first 570 _citation.page_last 584 _citation.year 2008 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18400178 _citation.pdbx_database_id_DOI 10.1016/j.str.2008.01.015 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Koharudin, L.M.' 1 ? primary 'Viscomi, A.R.' 2 ? primary 'Jee, J.G.' 3 ? primary 'Ottonello, S.' 4 ? primary 'Gronenborn, A.M.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cyanovirin-N homolog' _entity.formula_weight 13221.344 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cyanovirin-N-like protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMSFHVTAEDARIEVRDNRTILFARLRREDGEWNDASYELDQIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPI LRARLRDCNGEFHDRDVNLTEIVENVNGEFQAKF ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMSFHVTAEDARIEVRDNRTILFARLRREDGEWNDASYELDQIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPI LRARLRDCNGEFHDRDVNLTEIVENVNGEFQAKF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 SER n 1 6 PHE n 1 7 HIS n 1 8 VAL n 1 9 THR n 1 10 ALA n 1 11 GLU n 1 12 ASP n 1 13 ALA n 1 14 ARG n 1 15 ILE n 1 16 GLU n 1 17 VAL n 1 18 ARG n 1 19 ASP n 1 20 ASN n 1 21 ARG n 1 22 THR n 1 23 ILE n 1 24 LEU n 1 25 PHE n 1 26 ALA n 1 27 ARG n 1 28 LEU n 1 29 ARG n 1 30 ARG n 1 31 GLU n 1 32 ASP n 1 33 GLY n 1 34 GLU n 1 35 TRP n 1 36 ASN n 1 37 ASP n 1 38 ALA n 1 39 SER n 1 40 TYR n 1 41 GLU n 1 42 LEU n 1 43 ASP n 1 44 GLN n 1 45 ILE n 1 46 ILE n 1 47 GLY n 1 48 ASN n 1 49 ASN n 1 50 ASP n 1 51 GLY n 1 52 HIS n 1 53 PHE n 1 54 GLN n 1 55 TRP n 1 56 GLY n 1 57 GLY n 1 58 GLN n 1 59 ASN n 1 60 PHE n 1 61 THR n 1 62 GLU n 1 63 THR n 1 64 ALA n 1 65 GLU n 1 66 ASP n 1 67 ILE n 1 68 ARG n 1 69 PHE n 1 70 HIS n 1 71 PRO n 1 72 LYS n 1 73 GLU n 1 74 GLY n 1 75 ALA n 1 76 ALA n 1 77 GLU n 1 78 GLN n 1 79 PRO n 1 80 ILE n 1 81 LEU n 1 82 ARG n 1 83 ALA n 1 84 ARG n 1 85 LEU n 1 86 ARG n 1 87 ASP n 1 88 CYS n 1 89 ASN n 1 90 GLY n 1 91 GLU n 1 92 PHE n 1 93 HIS n 1 94 ASP n 1 95 ARG n 1 96 ASP n 1 97 VAL n 1 98 ASN n 1 99 LEU n 1 100 THR n 1 101 GLU n 1 102 ILE n 1 103 VAL n 1 104 GLU n 1 105 ASN n 1 106 VAL n 1 107 ASN n 1 108 GLY n 1 109 GLU n 1 110 PHE n 1 111 GLN n 1 112 ALA n 1 113 LYS n 1 114 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Neurospora _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Neurospora crassa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5141 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q7S6U4_NEUCR _struct_ref.pdbx_db_accession Q7S6U4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSFHVTAEDARIEVRDNRTILFARLRREDGEWNDASYELDQIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPILRA RLRDCNGEFHDRDVNLTEIVENVNGEFQAKF ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JZL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7S6U4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 111 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 111 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JZL GLY A 1 ? UNP Q7S6U4 ? ? 'expression tag' -2 1 1 2JZL SER A 2 ? UNP Q7S6U4 ? ? 'expression tag' -1 2 1 2JZL HIS A 3 ? UNP Q7S6U4 ? ? 'expression tag' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '3D CBCA(CO)NH' 1 3 2 '3D HNCACB' 1 4 2 '3D HCCH-TOCSY' 1 5 2 '3D H(CCO)NH' 1 6 2 '3D H(CCO)NH' 1 7 2 '15N-NOESY HSQC' 1 8 2 '13C-NOESY HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.0 mM [U-100% 15N] NcCVNH, 20 mM sodium phosphate, 0.02 % sodium azide, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1.0 mM [U-100% 13C; U-100% 15N] NcCVNH, 20 mM sodium phosphate, 0.02 % sodium azide, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker DRX 1 'Bruker DRX' 700 Bruker DRX 2 'Bruker DRX' 800 Bruker DRX 3 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2JZL _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'SA using CNS followed by explicit water refinement implemenetd in ARIA' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 800 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JZL _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JZL _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Johnson, One Moon Scientific' processing NMRView ? 3 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 4 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 5 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 6 'Cornilescu, Delaglio and Bax' 'iterative matrix relaxation' TALOS ? 7 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA ? 8 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 9 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JZL _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JZL _struct.title 'Structure of NcCVNH (N. CRASSA CVNH)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JZL _struct_keywords.pdbx_keywords 'Carbohydrate binding protein' _struct_keywords.text 'CVNH, ANTIVIRAL PROTEIN, Carbohydrate binding protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 43 ? ILE A 45 ? ASP A 40 ILE A 42 5 ? 3 HELX_P HELX_P2 2 ASN A 59 ? GLU A 62 ? ASN A 56 GLU A 59 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? C ? 3 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 14 ? ARG A 18 ? ARG A 11 ARG A 15 A 2 ARG A 21 ? ARG A 29 ? ARG A 18 ARG A 26 A 3 TRP A 35 ? GLU A 41 ? TRP A 32 GLU A 38 B 1 ASN A 48 ? ASN A 49 ? ASN A 45 ASN A 46 B 2 HIS A 52 ? PHE A 53 ? HIS A 49 PHE A 50 C 1 ALA A 64 ? HIS A 70 ? ALA A 61 HIS A 67 C 2 ILE A 80 ? ARG A 86 ? ILE A 77 ARG A 83 C 3 PHE A 92 ? VAL A 97 ? PHE A 89 VAL A 94 D 1 VAL A 103 ? ASN A 105 ? VAL A 100 ASN A 102 D 2 PHE A 110 ? ALA A 112 ? PHE A 107 ALA A 109 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 18 ? N ARG A 15 O ARG A 21 ? O ARG A 18 A 2 3 N LEU A 28 ? N LEU A 25 O ASN A 36 ? O ASN A 33 B 1 2 N ASN A 49 ? N ASN A 46 O HIS A 52 ? O HIS A 49 C 1 2 N GLU A 65 ? N GLU A 62 O ARG A 84 ? O ARG A 81 C 2 3 N LEU A 81 ? N LEU A 78 O VAL A 97 ? O VAL A 94 D 1 2 N GLU A 104 ? N GLU A 101 O GLN A 111 ? O GLN A 108 # _atom_sites.entry_id 2JZL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 SER 5 2 2 SER SER A . n A 1 6 PHE 6 3 3 PHE PHE A . n A 1 7 HIS 7 4 4 HIS HIS A . n A 1 8 VAL 8 5 5 VAL VAL A . n A 1 9 THR 9 6 6 THR THR A . n A 1 10 ALA 10 7 7 ALA ALA A . n A 1 11 GLU 11 8 8 GLU GLU A . n A 1 12 ASP 12 9 9 ASP ASP A . n A 1 13 ALA 13 10 10 ALA ALA A . n A 1 14 ARG 14 11 11 ARG ARG A . n A 1 15 ILE 15 12 12 ILE ILE A . n A 1 16 GLU 16 13 13 GLU GLU A . n A 1 17 VAL 17 14 14 VAL VAL A . n A 1 18 ARG 18 15 15 ARG ARG A . n A 1 19 ASP 19 16 16 ASP ASP A . n A 1 20 ASN 20 17 17 ASN ASN A . n A 1 21 ARG 21 18 18 ARG ARG A . n A 1 22 THR 22 19 19 THR THR A . n A 1 23 ILE 23 20 20 ILE ILE A . n A 1 24 LEU 24 21 21 LEU LEU A . n A 1 25 PHE 25 22 22 PHE PHE A . n A 1 26 ALA 26 23 23 ALA ALA A . n A 1 27 ARG 27 24 24 ARG ARG A . n A 1 28 LEU 28 25 25 LEU LEU A . n A 1 29 ARG 29 26 26 ARG ARG A . n A 1 30 ARG 30 27 27 ARG ARG A . n A 1 31 GLU 31 28 28 GLU GLU A . n A 1 32 ASP 32 29 29 ASP ASP A . n A 1 33 GLY 33 30 30 GLY GLY A . n A 1 34 GLU 34 31 31 GLU GLU A . n A 1 35 TRP 35 32 32 TRP TRP A . n A 1 36 ASN 36 33 33 ASN ASN A . n A 1 37 ASP 37 34 34 ASP ASP A . n A 1 38 ALA 38 35 35 ALA ALA A . n A 1 39 SER 39 36 36 SER SER A . n A 1 40 TYR 40 37 37 TYR TYR A . n A 1 41 GLU 41 38 38 GLU GLU A . n A 1 42 LEU 42 39 39 LEU LEU A . n A 1 43 ASP 43 40 40 ASP ASP A . n A 1 44 GLN 44 41 41 GLN GLN A . n A 1 45 ILE 45 42 42 ILE ILE A . n A 1 46 ILE 46 43 43 ILE ILE A . n A 1 47 GLY 47 44 44 GLY GLY A . n A 1 48 ASN 48 45 45 ASN ASN A . n A 1 49 ASN 49 46 46 ASN ASN A . n A 1 50 ASP 50 47 47 ASP ASP A . n A 1 51 GLY 51 48 48 GLY GLY A . n A 1 52 HIS 52 49 49 HIS HIS A . n A 1 53 PHE 53 50 50 PHE PHE A . n A 1 54 GLN 54 51 51 GLN GLN A . n A 1 55 TRP 55 52 52 TRP TRP A . n A 1 56 GLY 56 53 53 GLY GLY A . n A 1 57 GLY 57 54 54 GLY GLY A . n A 1 58 GLN 58 55 55 GLN GLN A . n A 1 59 ASN 59 56 56 ASN ASN A . n A 1 60 PHE 60 57 57 PHE PHE A . n A 1 61 THR 61 58 58 THR THR A . n A 1 62 GLU 62 59 59 GLU GLU A . n A 1 63 THR 63 60 60 THR THR A . n A 1 64 ALA 64 61 61 ALA ALA A . n A 1 65 GLU 65 62 62 GLU GLU A . n A 1 66 ASP 66 63 63 ASP ASP A . n A 1 67 ILE 67 64 64 ILE ILE A . n A 1 68 ARG 68 65 65 ARG ARG A . n A 1 69 PHE 69 66 66 PHE PHE A . n A 1 70 HIS 70 67 67 HIS HIS A . n A 1 71 PRO 71 68 68 PRO PRO A . n A 1 72 LYS 72 69 69 LYS LYS A . n A 1 73 GLU 73 70 70 GLU GLU A . n A 1 74 GLY 74 71 71 GLY GLY A . n A 1 75 ALA 75 72 72 ALA ALA A . n A 1 76 ALA 76 73 73 ALA ALA A . n A 1 77 GLU 77 74 74 GLU GLU A . n A 1 78 GLN 78 75 75 GLN GLN A . n A 1 79 PRO 79 76 76 PRO PRO A . n A 1 80 ILE 80 77 77 ILE ILE A . n A 1 81 LEU 81 78 78 LEU LEU A . n A 1 82 ARG 82 79 79 ARG ARG A . n A 1 83 ALA 83 80 80 ALA ALA A . n A 1 84 ARG 84 81 81 ARG ARG A . n A 1 85 LEU 85 82 82 LEU LEU A . n A 1 86 ARG 86 83 83 ARG ARG A . n A 1 87 ASP 87 84 84 ASP ASP A . n A 1 88 CYS 88 85 85 CYS CYS A . n A 1 89 ASN 89 86 86 ASN ASN A . n A 1 90 GLY 90 87 87 GLY GLY A . n A 1 91 GLU 91 88 88 GLU GLU A . n A 1 92 PHE 92 89 89 PHE PHE A . n A 1 93 HIS 93 90 90 HIS HIS A . n A 1 94 ASP 94 91 91 ASP ASP A . n A 1 95 ARG 95 92 92 ARG ARG A . n A 1 96 ASP 96 93 93 ASP ASP A . n A 1 97 VAL 97 94 94 VAL VAL A . n A 1 98 ASN 98 95 95 ASN ASN A . n A 1 99 LEU 99 96 96 LEU LEU A . n A 1 100 THR 100 97 97 THR THR A . n A 1 101 GLU 101 98 98 GLU GLU A . n A 1 102 ILE 102 99 99 ILE ILE A . n A 1 103 VAL 103 100 100 VAL VAL A . n A 1 104 GLU 104 101 101 GLU GLU A . n A 1 105 ASN 105 102 102 ASN ASN A . n A 1 106 VAL 106 103 103 VAL VAL A . n A 1 107 ASN 107 104 104 ASN ASN A . n A 1 108 GLY 108 105 105 GLY GLY A . n A 1 109 GLU 109 106 106 GLU GLU A . n A 1 110 PHE 110 107 107 PHE PHE A . n A 1 111 GLN 111 108 108 GLN GLN A . n A 1 112 ALA 112 109 109 ALA ALA A . n A 1 113 LYS 113 110 110 LYS LYS A . n A 1 114 PHE 114 111 111 PHE PHE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-03-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct.title' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id NcCVNH 1.0 mM '[U-100% 15N]' 1 'sodium phosphate' 20 mM ? 1 'sodium azide' 0.02 % ? 1 NcCVNH 1.0 mM '[U-100% 13C; U-100% 15N]' 2 'sodium phosphate' 20 mM ? 2 'sodium azide' 0.02 % ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 8 ? ? HH21 A ARG 24 ? ? 1.60 2 3 OD1 A ASP 47 ? ? HG A CYS 85 ? ? 1.59 3 6 OD1 A ASP 47 ? ? HG A CYS 85 ? ? 1.56 4 6 OE1 A GLU 101 ? ? HZ1 A LYS 110 ? ? 1.58 5 9 HH21 A ARG 15 ? ? OE2 A GLU 38 ? ? 1.59 6 17 OD1 A ASP 47 ? ? HG A CYS 85 ? ? 1.58 7 20 OD2 A ASP 47 ? ? HG A CYS 85 ? ? 1.59 8 28 OD2 A ASP 47 ? ? HG A CYS 85 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 4 ? ? -163.08 64.46 2 1 VAL A 5 ? ? 70.85 -78.15 3 1 ASN A 56 ? ? -82.37 49.17 4 1 ILE A 64 ? ? -68.04 89.46 5 2 ASN A 56 ? ? -85.16 48.95 6 2 VAL A 103 ? ? -110.75 65.44 7 3 PHE A 3 ? ? -178.35 -40.22 8 3 ASN A 56 ? ? -82.02 48.75 9 3 ILE A 64 ? ? -66.35 93.24 10 4 SER A 2 ? ? 60.85 80.28 11 4 PHE A 3 ? ? -162.67 -43.86 12 4 ASN A 56 ? ? -84.67 49.65 13 4 ILE A 64 ? ? -66.41 90.15 14 5 HIS A 4 ? ? -88.92 -80.99 15 5 ASP A 47 ? ? 49.51 28.92 16 5 ASN A 56 ? ? -85.75 48.37 17 5 ILE A 64 ? ? -67.93 87.73 18 5 VAL A 103 ? ? -110.03 68.74 19 6 SER A 2 ? ? 71.18 -61.21 20 6 THR A 6 ? ? -163.13 -50.30 21 6 ASN A 56 ? ? -83.32 48.96 22 7 VAL A 5 ? ? 54.24 75.23 23 7 ASN A 56 ? ? -82.68 48.93 24 7 ILE A 64 ? ? -67.65 90.77 25 8 PHE A 3 ? ? 58.14 70.16 26 8 THR A 6 ? ? -127.89 -70.47 27 8 ASN A 56 ? ? -84.55 49.15 28 8 ILE A 64 ? ? -69.18 89.63 29 8 VAL A 103 ? ? -116.72 69.90 30 9 ASN A 56 ? ? -85.01 47.20 31 10 VAL A 5 ? ? -59.34 102.65 32 10 ASN A 56 ? ? -84.29 48.95 33 10 ILE A 64 ? ? -66.95 89.95 34 11 THR A 6 ? ? -111.47 -131.24 35 11 ASN A 56 ? ? -87.09 47.94 36 11 ILE A 64 ? ? -66.54 91.44 37 12 THR A 6 ? ? -113.34 -75.86 38 12 ASN A 56 ? ? -83.96 49.09 39 12 ILE A 64 ? ? -66.46 91.58 40 13 HIS A 4 ? ? -144.63 -69.30 41 13 ASN A 56 ? ? -84.65 49.37 42 13 ILE A 64 ? ? -66.96 88.96 43 14 ASN A 56 ? ? -82.82 49.39 44 14 ILE A 64 ? ? -68.48 91.91 45 15 SER A 2 ? ? 62.85 -174.72 46 15 HIS A 4 ? ? -178.52 -31.00 47 15 ASN A 56 ? ? -83.95 48.75 48 15 ILE A 64 ? ? -69.94 89.68 49 16 SER A 2 ? ? -131.95 -63.34 50 16 PHE A 3 ? ? 69.95 -57.00 51 16 THR A 6 ? ? 61.56 119.69 52 16 ASN A 56 ? ? -86.16 47.96 53 17 ASN A 56 ? ? -85.79 49.28 54 17 VAL A 103 ? ? -110.28 69.89 55 18 ASN A 56 ? ? -85.32 47.83 56 19 PHE A 3 ? ? 67.73 -176.87 57 19 ASN A 56 ? ? -84.38 47.39 58 20 PHE A 3 ? ? 66.11 175.19 59 20 THR A 6 ? ? -112.51 -79.68 60 20 ASN A 56 ? ? -87.25 48.17 61 20 ILE A 64 ? ? -69.42 91.74 62 21 PHE A 3 ? ? -106.92 -73.26 63 21 HIS A 4 ? ? -83.09 41.16 64 21 ASN A 56 ? ? -84.42 49.03 65 22 HIS A 4 ? ? 67.93 -87.25 66 22 VAL A 5 ? ? 176.69 123.69 67 22 THR A 6 ? ? -91.40 -75.00 68 22 ASN A 56 ? ? -85.29 49.59 69 22 ILE A 64 ? ? -68.97 89.53 70 23 SER A 2 ? ? 69.39 134.44 71 23 PHE A 3 ? ? -174.63 -33.56 72 23 ASN A 56 ? ? -84.54 49.14 73 23 ILE A 64 ? ? -66.70 94.63 74 24 VAL A 5 ? ? 59.38 98.41 75 24 ASN A 56 ? ? -83.60 48.31 76 24 ILE A 64 ? ? -69.94 94.49 77 25 VAL A 5 ? ? 39.23 51.63 78 25 ASN A 56 ? ? -84.12 48.09 79 25 VAL A 103 ? ? -119.29 69.07 80 25 ASN A 104 ? ? 61.36 61.46 81 26 SER A 2 ? ? 73.48 -55.28 82 26 VAL A 5 ? ? -144.09 -28.40 83 26 THR A 6 ? ? -68.75 -81.16 84 26 ASN A 56 ? ? -79.69 49.43 85 26 ILE A 64 ? ? -67.59 94.11 86 27 PHE A 3 ? ? 70.17 154.25 87 27 HIS A 4 ? ? -146.93 -40.59 88 27 ASN A 56 ? ? -81.55 45.60 89 27 ILE A 64 ? ? -68.32 91.22 90 28 SER A 2 ? ? -124.38 -93.52 91 28 VAL A 5 ? ? -137.98 -53.10 92 28 THR A 6 ? ? -123.27 -63.91 93 28 ASP A 9 ? ? 39.74 44.60 94 28 ASN A 56 ? ? -83.73 44.86 95 28 ILE A 64 ? ? -67.03 89.81 96 28 VAL A 103 ? ? -116.14 63.96 97 28 ASN A 104 ? ? 63.80 61.57 98 29 ASN A 56 ? ? -84.93 49.58 99 29 ILE A 64 ? ? -68.27 91.58 100 30 PHE A 3 ? ? -121.25 -67.90 101 30 VAL A 5 ? ? -155.17 -60.96 102 30 THR A 6 ? ? 69.04 -65.03 103 30 ASN A 56 ? ? -83.92 48.78 104 30 VAL A 103 ? ? -113.94 67.29 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 2 Y 1 A GLY -2 ? A GLY 1 5 2 Y 1 A SER -1 ? A SER 2 6 2 Y 1 A HIS 0 ? A HIS 3 7 3 Y 1 A GLY -2 ? A GLY 1 8 3 Y 1 A SER -1 ? A SER 2 9 3 Y 1 A HIS 0 ? A HIS 3 10 4 Y 1 A GLY -2 ? A GLY 1 11 4 Y 1 A SER -1 ? A SER 2 12 4 Y 1 A HIS 0 ? A HIS 3 13 5 Y 1 A GLY -2 ? A GLY 1 14 5 Y 1 A SER -1 ? A SER 2 15 5 Y 1 A HIS 0 ? A HIS 3 16 6 Y 1 A GLY -2 ? A GLY 1 17 6 Y 1 A SER -1 ? A SER 2 18 6 Y 1 A HIS 0 ? A HIS 3 19 7 Y 1 A GLY -2 ? A GLY 1 20 7 Y 1 A SER -1 ? A SER 2 21 7 Y 1 A HIS 0 ? A HIS 3 22 8 Y 1 A GLY -2 ? A GLY 1 23 8 Y 1 A SER -1 ? A SER 2 24 8 Y 1 A HIS 0 ? A HIS 3 25 9 Y 1 A GLY -2 ? A GLY 1 26 9 Y 1 A SER -1 ? A SER 2 27 9 Y 1 A HIS 0 ? A HIS 3 28 10 Y 1 A GLY -2 ? A GLY 1 29 10 Y 1 A SER -1 ? A SER 2 30 10 Y 1 A HIS 0 ? A HIS 3 31 11 Y 1 A GLY -2 ? A GLY 1 32 11 Y 1 A SER -1 ? A SER 2 33 11 Y 1 A HIS 0 ? A HIS 3 34 12 Y 1 A GLY -2 ? A GLY 1 35 12 Y 1 A SER -1 ? A SER 2 36 12 Y 1 A HIS 0 ? A HIS 3 37 13 Y 1 A GLY -2 ? A GLY 1 38 13 Y 1 A SER -1 ? A SER 2 39 13 Y 1 A HIS 0 ? A HIS 3 40 14 Y 1 A GLY -2 ? A GLY 1 41 14 Y 1 A SER -1 ? A SER 2 42 14 Y 1 A HIS 0 ? A HIS 3 43 15 Y 1 A GLY -2 ? A GLY 1 44 15 Y 1 A SER -1 ? A SER 2 45 15 Y 1 A HIS 0 ? A HIS 3 46 16 Y 1 A GLY -2 ? A GLY 1 47 16 Y 1 A SER -1 ? A SER 2 48 16 Y 1 A HIS 0 ? A HIS 3 49 17 Y 1 A GLY -2 ? A GLY 1 50 17 Y 1 A SER -1 ? A SER 2 51 17 Y 1 A HIS 0 ? A HIS 3 52 18 Y 1 A GLY -2 ? A GLY 1 53 18 Y 1 A SER -1 ? A SER 2 54 18 Y 1 A HIS 0 ? A HIS 3 55 19 Y 1 A GLY -2 ? A GLY 1 56 19 Y 1 A SER -1 ? A SER 2 57 19 Y 1 A HIS 0 ? A HIS 3 58 20 Y 1 A GLY -2 ? A GLY 1 59 20 Y 1 A SER -1 ? A SER 2 60 20 Y 1 A HIS 0 ? A HIS 3 61 21 Y 1 A GLY -2 ? A GLY 1 62 21 Y 1 A SER -1 ? A SER 2 63 21 Y 1 A HIS 0 ? A HIS 3 64 22 Y 1 A GLY -2 ? A GLY 1 65 22 Y 1 A SER -1 ? A SER 2 66 22 Y 1 A HIS 0 ? A HIS 3 67 23 Y 1 A GLY -2 ? A GLY 1 68 23 Y 1 A SER -1 ? A SER 2 69 23 Y 1 A HIS 0 ? A HIS 3 70 24 Y 1 A GLY -2 ? A GLY 1 71 24 Y 1 A SER -1 ? A SER 2 72 24 Y 1 A HIS 0 ? A HIS 3 73 25 Y 1 A GLY -2 ? A GLY 1 74 25 Y 1 A SER -1 ? A SER 2 75 25 Y 1 A HIS 0 ? A HIS 3 76 26 Y 1 A GLY -2 ? A GLY 1 77 26 Y 1 A SER -1 ? A SER 2 78 26 Y 1 A HIS 0 ? A HIS 3 79 27 Y 1 A GLY -2 ? A GLY 1 80 27 Y 1 A SER -1 ? A SER 2 81 27 Y 1 A HIS 0 ? A HIS 3 82 28 Y 1 A GLY -2 ? A GLY 1 83 28 Y 1 A SER -1 ? A SER 2 84 28 Y 1 A HIS 0 ? A HIS 3 85 29 Y 1 A GLY -2 ? A GLY 1 86 29 Y 1 A SER -1 ? A SER 2 87 29 Y 1 A HIS 0 ? A HIS 3 88 30 Y 1 A GLY -2 ? A GLY 1 89 30 Y 1 A SER -1 ? A SER 2 90 30 Y 1 A HIS 0 ? A HIS 3 #