data_2K14 # _entry.id 2K14 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K14 pdb_00002k14 10.2210/pdb2k14/pdb RCSB RCSB100543 ? ? WWPDB D_1000100543 ? ? # _pdbx_database_related.db_id 15475 _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Entry containing the chemical shift assignment of the C-terminal domain of YuaF' _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K14 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-02-20 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Walker, C.A.' 1 'Hinderhofer, M.' 2 'Witte, D.J.' 3 'Boos, W.' 4 'Moller, H.M.' 5 # _citation.id primary _citation.title 'Solution structure of the soluble domain of the NfeD protein YuaF from Bacillus subtilis.' _citation.journal_abbrev J.Biomol.Nmr _citation.journal_volume 42 _citation.page_first 69 _citation.page_last 76 _citation.year 2008 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18696230 _citation.pdbx_database_id_DOI 10.1007/s10858-008-9261-3 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Walker, C.A.' 1 ? primary 'Hinderhofer, M.' 2 ? primary 'Witte, D.J.' 3 ? primary 'Boos, W.' 4 ? primary 'Moller, H.M.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'YuaF protein' _entity.formula_weight 8850.825 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-terminal domain (UNP residues 97-174)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMLESSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTP HEPI ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMLESSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTP HEPI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 LEU n 1 6 GLU n 1 7 SER n 1 8 SER n 1 9 ALA n 1 10 GLU n 1 11 GLU n 1 12 SER n 1 13 LEU n 1 14 ALA n 1 15 TYR n 1 16 ARG n 1 17 GLU n 1 18 ASP n 1 19 ASP n 1 20 LEU n 1 21 ARG n 1 22 GLY n 1 23 ARG n 1 24 LEU n 1 25 GLY n 1 26 LYS n 1 27 VAL n 1 28 ILE n 1 29 THR n 1 30 ALA n 1 31 VAL n 1 32 PRO n 1 33 VAL n 1 34 ASP n 1 35 GLY n 1 36 PHE n 1 37 GLY n 1 38 GLU n 1 39 VAL n 1 40 VAL n 1 41 ILE n 1 42 GLU n 1 43 GLY n 1 44 ILE n 1 45 GLY n 1 46 GLY n 1 47 THR n 1 48 ILE n 1 49 SER n 1 50 LYS n 1 51 SER n 1 52 ALA n 1 53 VAL n 1 54 SER n 1 55 PHE n 1 56 ASP n 1 57 ASN n 1 58 GLN n 1 59 GLN n 1 60 ILE n 1 61 SER n 1 62 TYR n 1 63 GLY n 1 64 THR n 1 65 THR n 1 66 VAL n 1 67 LEU n 1 68 VAL n 1 69 VAL n 1 70 ASP n 1 71 ILE n 1 72 ASN n 1 73 ASN n 1 74 GLY n 1 75 VAL n 1 76 LEU n 1 77 SER n 1 78 VAL n 1 79 THR n 1 80 PRO n 1 81 HIS n 1 82 GLU n 1 83 PRO n 1 84 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene yuaF _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'Marburg 168' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pHIHO1421 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ;The plasmid pHIHO1421 was constructed by fusing the coding sequence of residues 97-174 of YuaF to the 3'-end of the malE gene containing an additional thrombin cleavage site. The soluble C-terminal domain of YuaF was generated by cleaving off the malE part by digestion with thrombin. ; # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O32077_BACSU _struct_ref.pdbx_db_accession O32077 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI _struct_ref.pdbx_align_begin 97 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K14 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 84 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O32077 _struct_ref_seq.db_align_beg 97 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 174 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 7 _struct_ref_seq.pdbx_auth_seq_align_end 84 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K14 GLY A 1 ? UNP O32077 ? ? 'SEE REMARK 999' 1 1 1 2K14 SER A 2 ? UNP O32077 ? ? 'SEE REMARK 999' 2 2 1 2K14 HIS A 3 ? UNP O32077 ? ? 'SEE REMARK 999' 3 3 1 2K14 MET A 4 ? UNP O32077 ? ? 'SEE REMARK 999' 4 4 1 2K14 LEU A 5 ? UNP O32077 ? ? 'SEE REMARK 999' 5 5 1 2K14 GLU A 6 ? UNP O32077 ? ? 'SEE REMARK 999' 6 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HN(CA)CO' 1 6 1 '3D HNCACB' 1 7 3 '3D 1H-15N TOCSY' 1 8 3 '3D 1H-15N NOESY' 1 9 2 '3D HCCH-COSY' 1 10 2 '3D HCCH-TOCSY' 1 11 2 '3D 1H-13C NOESY' 1 12 2 '(HB)CB(CGCD)HD' 1 13 2 '(HB)CB(CGCDCE)HE' 1 14 2 '2D 1H-13C HSQC aromatic' 1 15 2 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 300 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 280 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.9 mM [U-13C; U-15N] YuaF, 50 mM TRIS, 300 mM sodium chloride, 4 mM sodium azide, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '0.9 mM [U-13C; U-15N] YuaF, 50 mM TRIS, 300 mM sodium chloride, 4 mM sodium azide, 100% D2O' 2 '100% D2O' '1 mM [U-15N] YuaF, 50 mM TRIS, 300 mM sodium chloride, 4 mM sodium azide, 95% H2O/5% D2O' 3 '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker 'AVANCE DRX' 1 'Bruker Avance DRX' 800 Bruker 'AVANCE III' 2 'Bruker Avance III' # _pdbx_nmr_refine.entry_id 2K14 _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ;400 Starting structures for refinement were generated with the final set of constraints by torsion angle dynamics in CYANA 2.0., Refinement of the final structural ensemble was carried out by molecular dynamics simulated annealing in AMBER 8. The 100 structures with lowest target function in CYANA 2.0 were imported into AMBER 8, minimized and subjected to simulated annealing in vacuum with charges reduced to 20% of their original value. The final round of simulated annealing was carried out within a generalized-Born solvation model with full charges followed by energy minimization. Constraints from CYANA were translated into AMBER 8 format taking stereospecific assignments, pseudoatom corrections and NOE-averaging into account. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K14 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.17 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K14 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.0 1 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, and Kollm' refinement Amber 8 2 'Bruker Biospin' collection XwinNMR 3.6 3 'Keller and Wuthrich' 'chemical shift assignment' CARA 1.8.4 4 'Bruker Biospin' processing TopSpin 1.3.b.20 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;This PBD entry contains the structure of residues 97 to 174 of YuaF (residues 7 to 84 of this entry). In addition, the structure includes six further residues (1-6) that originate from the MBP fusion construct. ; _exptl.entry_id 2K14 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K14 _struct.title 'Solution structure of the soluble domain of the NfeD protein YuaF from Bacillus subtilis' _struct.pdbx_model_details ;This PBD entry contains the structure of residues 97 to 174 of YuaF (residues 7 to 84 of this entry). In addition, the structure includes six further residues (1-6) that originate from the MBP fusion construct. ; _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K14 _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'YuaF, Bacillus subtilis, NfeD-like protein, cellular stress, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 1 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 20 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 1 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 20 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 24 ? THR A 29 ? LEU A 24 THR A 29 A 2 PHE A 36 ? ILE A 41 ? PHE A 36 ILE A 41 A 3 LYS A 50 ? SER A 54 ? LYS A 50 SER A 54 A 4 VAL A 75 ? THR A 79 ? VAL A 75 THR A 79 A 5 THR A 65 ? ASN A 72 ? THR A 65 ASN A 72 A 6 LEU A 24 ? THR A 29 ? LEU A 24 THR A 29 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 26 ? N LYS A 26 O VAL A 40 ? O VAL A 40 A 2 3 N VAL A 39 ? N VAL A 39 O LYS A 50 ? O LYS A 50 A 3 4 N VAL A 53 ? N VAL A 53 O VAL A 78 ? O VAL A 78 A 4 5 O SER A 77 ? O SER A 77 N ASP A 70 ? N ASP A 70 A 5 6 O VAL A 66 ? O VAL A 66 N GLY A 25 ? N GLY A 25 # _atom_sites.entry_id 2K14 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ILE 84 84 84 ILE ILE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-08-26 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_entry_details.entry_id 2K14 _pdbx_entry_details.sequence_details ;THIS PBD ENTRY CONTAINS THE STRUCTURE OF RESIDUES 97 TO 174 OF YUAF (RESIDUES 7 TO 84 OF THIS ENTRY). IN ADDITION, THE STRUCTURE INCLUDES SIX FURTHER RESIDUES (1-6) THAT ORIGINATE FROM THE MBP FUSION CONSTRUCT. ; _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.088 _pdbx_nmr_ensemble_rms.distance_rms_dev_error ? _pdbx_nmr_ensemble_rms.entry_id 2K14 _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id YuaF 0.9 mM '[U-13C; U-15N]' 1 TRIS 50 mM ? 1 'sodium chloride' 300 mM ? 1 'sodium azide' 4 mM ? 1 YuaF 0.9 mM '[U-13C; U-15N]' 2 TRIS 50 mM ? 2 'sodium chloride' 300 mM ? 2 'sodium azide' 4 mM ? 2 YuaF 1 mM '[U-15N]' 3 TRIS 50 mM ? 3 'sodium chloride' 300 mM ? 3 'sodium azide' 4 mM ? 3 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2K14 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1526 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 379 _pdbx_nmr_constraints.NOE_long_range_total_count 522 _pdbx_nmr_constraints.NOE_medium_range_total_count 214 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 411 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 9 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 123.34 120.30 3.04 0.50 N 2 16 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 124.41 120.30 4.11 0.50 N 3 18 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 124.29 120.30 3.99 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 34 ? ? -145.80 23.45 2 1 ASN A 73 ? ? -50.21 99.18 3 1 GLU A 82 ? ? 35.17 58.60 4 2 ASP A 34 ? ? -141.29 24.41 5 2 GLU A 82 ? ? 35.71 56.88 6 3 ASP A 34 ? ? -141.03 24.44 7 3 ASN A 73 ? ? -50.33 98.76 8 3 GLU A 82 ? ? 37.16 56.53 9 4 ASP A 34 ? ? -143.26 31.57 10 4 GLU A 82 ? ? 38.79 55.98 11 5 ASP A 34 ? ? -143.05 24.07 12 5 GLU A 82 ? ? 35.80 55.53 13 6 ASP A 34 ? ? -140.83 24.35 14 6 ASN A 73 ? ? 34.60 55.96 15 6 GLU A 82 ? ? 35.21 52.03 16 7 ASP A 34 ? ? -145.03 30.99 17 7 GLU A 42 ? ? -49.76 -19.30 18 7 GLU A 82 ? ? 39.00 53.93 19 8 ASP A 34 ? ? -142.85 31.46 20 8 ASN A 73 ? ? -47.52 95.78 21 8 GLU A 82 ? ? 38.95 54.27 22 9 ASP A 34 ? ? -142.42 31.67 23 9 GLU A 82 ? ? 38.12 56.05 24 10 ASP A 34 ? ? -145.46 30.86 25 10 GLU A 42 ? ? -58.30 -9.93 26 10 GLU A 82 ? ? 38.99 53.63 27 11 ASP A 34 ? ? -143.13 24.06 28 11 GLU A 82 ? ? 35.36 56.50 29 12 ASP A 34 ? ? -143.23 24.02 30 12 ASN A 73 ? ? -50.30 99.39 31 12 GLU A 82 ? ? 28.89 61.68 32 13 ASP A 34 ? ? -142.59 31.38 33 13 GLU A 82 ? ? 38.29 56.20 34 14 ASP A 34 ? ? -142.62 31.58 35 14 GLU A 82 ? ? 35.18 61.14 36 15 ASP A 34 ? ? -143.62 30.83 37 15 ASN A 73 ? ? -50.42 99.11 38 15 GLU A 82 ? ? 36.28 56.30 39 16 ASP A 34 ? ? -142.18 31.26 40 16 GLU A 82 ? ? 37.15 54.27 41 17 ASP A 34 ? ? -145.54 31.19 42 17 ASN A 73 ? ? -50.25 99.28 43 17 GLU A 82 ? ? 36.05 56.42 44 18 ASP A 34 ? ? -145.47 31.08 45 18 GLU A 82 ? ? 36.71 51.36 46 19 ASP A 34 ? ? -145.89 30.84 47 19 ASN A 73 ? ? -49.83 99.17 48 19 GLU A 82 ? ? 37.21 54.24 49 20 ASP A 34 ? ? -142.55 32.19 50 20 GLU A 82 ? ? 39.38 53.72 #