data_2K29
# 
_entry.id   2K29 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2K29         pdb_00002k29 10.2210/pdb2k29/pdb 
RCSB  RCSB100584   ?            ?                   
WWPDB D_1000100584 ?            ?                   
BMRB  15691        ?            10.13018/BMR15691   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-04-22 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2020-02-19 
4 'Structure model' 1 3 2023-06-14 
5 'Structure model' 1 4 2024-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
3 3 'Structure model' 'Derived calculations'      
4 3 'Structure model' Other                       
5 4 'Structure model' 'Database references'       
6 4 'Structure model' Other                       
7 5 'Structure model' 'Data collection'           
8 5 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' database_2            
2  3 'Structure model' pdbx_database_status  
3  3 'Structure model' pdbx_struct_assembly  
4  3 'Structure model' pdbx_struct_oper_list 
5  3 'Structure model' struct_ref_seq_dif    
6  4 'Structure model' database_2            
7  4 'Structure model' pdbx_database_status  
8  5 'Structure model' chem_comp_atom        
9  5 'Structure model' chem_comp_bond        
10 5 'Structure model' database_2            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_pdbx_database_status.status_code_cs'       
2 3 'Structure model' '_struct_ref_seq_dif.details'                
3 4 'Structure model' '_database_2.pdbx_DOI'                       
4 4 'Structure model' '_database_2.pdbx_database_accession'        
5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 
6 5 'Structure model' '_database_2.pdbx_DOI'                       
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2K29 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-03-28 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            REL 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          15691 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        . 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, G.'     1 
'Zhang, Y.'  2 
'Inouye, M.' 3 
'Ikura, M.'  4 
# 
_citation.id                        primary 
_citation.title                     
'Structural mechanism of transcriptional autorepression of the Escherichia coli RelB/RelE antitoxin/toxin module.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            380 
_citation.page_first                107 
_citation.page_last                 119 
_citation.year                      2008 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18501926 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2008.04.039 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, G.Y.'   1 ? 
primary 'Zhang, Y.'  2 ? 
primary 'Inouye, M.' 3 ? 
primary 'Ikura, M.'  4 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Antitoxin RelB' 
_entity.formula_weight             6001.910 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'DNA binding domain, UNP residues 4-53' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSHMGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTL 
_entity_poly.pdbx_seq_one_letter_code_can   GSHMGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTL 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  HIS n 
1 4  MET n 
1 5  GLY n 
1 6  SER n 
1 7  ILE n 
1 8  ASN n 
1 9  LEU n 
1 10 ARG n 
1 11 ILE n 
1 12 ASP n 
1 13 ASP n 
1 14 GLU n 
1 15 LEU n 
1 16 LYS n 
1 17 ALA n 
1 18 ARG n 
1 19 SER n 
1 20 TYR n 
1 21 ALA n 
1 22 ALA n 
1 23 LEU n 
1 24 GLU n 
1 25 LYS n 
1 26 MET n 
1 27 GLY n 
1 28 VAL n 
1 29 THR n 
1 30 PRO n 
1 31 SER n 
1 32 GLU n 
1 33 ALA n 
1 34 LEU n 
1 35 ARG n 
1 36 LEU n 
1 37 MET n 
1 38 LEU n 
1 39 GLU n 
1 40 TYR n 
1 41 ILE n 
1 42 ALA n 
1 43 ASP n 
1 44 ASN n 
1 45 GLU n 
1 46 ARG n 
1 47 LEU n 
1 48 PRO n 
1 49 PHE n 
1 50 LYS n 
1 51 GLN n 
1 52 THR n 
1 53 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 relB 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              DE3 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               pET28a 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  -2  ?   ?   ?   A . n 
A 1 2  SER 2  -1  ?   ?   ?   A . n 
A 1 3  HIS 3  0   ?   ?   ?   A . n 
A 1 4  MET 4  1   1   MET MET A . n 
A 1 5  GLY 5  2   2   GLY GLY A . n 
A 1 6  SER 6  3   3   SER SER A . n 
A 1 7  ILE 7  4   4   ILE ILE A . n 
A 1 8  ASN 8  5   5   ASN ASN A . n 
A 1 9  LEU 9  6   6   LEU LEU A . n 
A 1 10 ARG 10 7   7   ARG ARG A . n 
A 1 11 ILE 11 8   8   ILE ILE A . n 
A 1 12 ASP 12 9   9   ASP ASP A . n 
A 1 13 ASP 13 10  10  ASP ASP A . n 
A 1 14 GLU 14 11  11  GLU GLU A . n 
A 1 15 LEU 15 12  12  LEU LEU A . n 
A 1 16 LYS 16 13  13  LYS LYS A . n 
A 1 17 ALA 17 14  14  ALA ALA A . n 
A 1 18 ARG 18 15  15  ARG ARG A . n 
A 1 19 SER 19 16  16  SER SER A . n 
A 1 20 TYR 20 17  17  TYR TYR A . n 
A 1 21 ALA 21 18  18  ALA ALA A . n 
A 1 22 ALA 22 19  19  ALA ALA A . n 
A 1 23 LEU 23 20  20  LEU LEU A . n 
A 1 24 GLU 24 21  21  GLU GLU A . n 
A 1 25 LYS 25 22  22  LYS LYS A . n 
A 1 26 MET 26 23  23  MET MET A . n 
A 1 27 GLY 27 24  24  GLY GLY A . n 
A 1 28 VAL 28 25  25  VAL VAL A . n 
A 1 29 THR 29 26  26  THR THR A . n 
A 1 30 PRO 30 27  27  PRO PRO A . n 
A 1 31 SER 31 28  28  SER SER A . n 
A 1 32 GLU 32 29  29  GLU GLU A . n 
A 1 33 ALA 33 30  30  ALA ALA A . n 
A 1 34 LEU 34 31  31  LEU LEU A . n 
A 1 35 ARG 35 32  32  ARG ARG A . n 
A 1 36 LEU 36 33  33  LEU LEU A . n 
A 1 37 MET 37 34  34  MET MET A . n 
A 1 38 LEU 38 35  35  LEU LEU A . n 
A 1 39 GLU 39 36  36  GLU GLU A . n 
A 1 40 TYR 40 37  37  TYR TYR A . n 
A 1 41 ILE 41 38  38  ILE ILE A . n 
A 1 42 ALA 42 39  39  ALA ALA A . n 
A 1 43 ASP 43 40  40  ASP ASP A . n 
A 1 44 ASN 44 41  41  ASN ASN A . n 
A 1 45 GLU 45 42  42  GLU GLU A . n 
A 1 46 ARG 46 43  43  ARG ARG A . n 
A 1 47 LEU 47 44  44  LEU LEU A . n 
A 1 48 PRO 48 45  45  PRO PRO A . n 
A 1 49 PHE 49 46  46  PHE PHE A . n 
A 1 50 LYS 50 47  47  LYS LYS A . n 
A 1 51 GLN 51 48  48  GLN GLN A . n 
A 1 52 THR 52 49  49  THR THR A . n 
A 1 53 LEU 53 50  50  LEU LEU A . n 
B 1 1  GLY 1  98  ?   ?   ?   B . n 
B 1 2  SER 2  99  ?   ?   ?   B . n 
B 1 3  HIS 3  100 ?   ?   ?   B . n 
B 1 4  MET 4  101 101 MET MET B . n 
B 1 5  GLY 5  102 102 GLY GLY B . n 
B 1 6  SER 6  103 103 SER SER B . n 
B 1 7  ILE 7  104 104 ILE ILE B . n 
B 1 8  ASN 8  105 105 ASN ASN B . n 
B 1 9  LEU 9  106 106 LEU LEU B . n 
B 1 10 ARG 10 107 107 ARG ARG B . n 
B 1 11 ILE 11 108 108 ILE ILE B . n 
B 1 12 ASP 12 109 109 ASP ASP B . n 
B 1 13 ASP 13 110 110 ASP ASP B . n 
B 1 14 GLU 14 111 111 GLU GLU B . n 
B 1 15 LEU 15 112 112 LEU LEU B . n 
B 1 16 LYS 16 113 113 LYS LYS B . n 
B 1 17 ALA 17 114 114 ALA ALA B . n 
B 1 18 ARG 18 115 115 ARG ARG B . n 
B 1 19 SER 19 116 116 SER SER B . n 
B 1 20 TYR 20 117 117 TYR TYR B . n 
B 1 21 ALA 21 118 118 ALA ALA B . n 
B 1 22 ALA 22 119 119 ALA ALA B . n 
B 1 23 LEU 23 120 120 LEU LEU B . n 
B 1 24 GLU 24 121 121 GLU GLU B . n 
B 1 25 LYS 25 122 122 LYS LYS B . n 
B 1 26 MET 26 123 123 MET MET B . n 
B 1 27 GLY 27 124 124 GLY GLY B . n 
B 1 28 VAL 28 125 125 VAL VAL B . n 
B 1 29 THR 29 126 126 THR THR B . n 
B 1 30 PRO 30 127 127 PRO PRO B . n 
B 1 31 SER 31 128 128 SER SER B . n 
B 1 32 GLU 32 129 129 GLU GLU B . n 
B 1 33 ALA 33 130 130 ALA ALA B . n 
B 1 34 LEU 34 131 131 LEU LEU B . n 
B 1 35 ARG 35 132 132 ARG ARG B . n 
B 1 36 LEU 36 133 133 LEU LEU B . n 
B 1 37 MET 37 134 134 MET MET B . n 
B 1 38 LEU 38 135 135 LEU LEU B . n 
B 1 39 GLU 39 136 136 GLU GLU B . n 
B 1 40 TYR 40 137 137 TYR TYR B . n 
B 1 41 ILE 41 138 138 ILE ILE B . n 
B 1 42 ALA 42 139 139 ALA ALA B . n 
B 1 43 ASP 43 140 140 ASP ASP B . n 
B 1 44 ASN 44 141 141 ASN ASN B . n 
B 1 45 GLU 45 142 142 GLU GLU B . n 
B 1 46 ARG 46 143 143 ARG ARG B . n 
B 1 47 LEU 47 144 144 LEU LEU B . n 
B 1 48 PRO 48 145 145 PRO PRO B . n 
B 1 49 PHE 49 146 146 PHE PHE B . n 
B 1 50 LYS 50 147 147 LYS LYS B . n 
B 1 51 GLN 51 148 148 GLN GLN B . n 
B 1 52 THR 52 149 149 THR THR B . n 
B 1 53 LEU 53 150 150 LEU LEU B . n 
# 
_cell.entry_id           2K29 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2K29 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    
;Ribbon-helix-helix family 
transcriptional repressor
;
_exptl.entry_id                   2K29 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2K29 
_struct.title                     'Structure of the DBD domain of E. coli antitoxin RelB' 
_struct.pdbx_model_details        
;Ribbon-helix-helix family 
transcriptional repressor
;
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2K29 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
'RelB, Ribbon-Helix-Helix, antitoxin, Repressor, Stress response, Transcription, Transcription regulation' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RELB_ECOLI 
_struct_ref.pdbx_db_accession          P0C079 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTL 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2K29 A 4 ? 53 ? P0C079 1 ? 50 ? 1   50  
2 1 2K29 B 4 ? 53 ? P0C079 1 ? 50 ? 101 150 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2K29 GLY A 1 ? UNP P0C079 ? ? 'expression tag' -2  1 
1 2K29 SER A 2 ? UNP P0C079 ? ? 'expression tag' -1  2 
1 2K29 HIS A 3 ? UNP P0C079 ? ? 'expression tag' 0   3 
2 2K29 GLY B 1 ? UNP P0C079 ? ? 'expression tag' 98  4 
2 2K29 SER B 2 ? UNP P0C079 ? ? 'expression tag' 99  5 
2 2K29 HIS B 3 ? UNP P0C079 ? ? 'expression tag' 100 6 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 12 ? MET A 26 ? ASP A 9   MET A 23  1 ? 15 
HELX_P HELX_P2 2 THR A 29 ? GLU A 45 ? THR A 26  GLU A 42  1 ? 17 
HELX_P HELX_P3 3 ASP B 12 ? MET B 26 ? ASP B 109 MET B 123 1 ? 15 
HELX_P HELX_P4 4 THR B 29 ? GLU B 45 ? THR B 126 GLU B 142 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 5 ? ILE A 11 ? GLY A 2   ILE A 8   
A 2 GLY B 5 ? ILE B 11 ? GLY B 102 ILE B 108 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    11 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     8 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   GLY 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   B 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    5 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    GLY 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    B 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     102 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  ARG A 43  ? ? -151.17 -40.95  
2   1  LEU A 44  ? ? 70.23   144.01  
3   1  LYS A 47  ? ? -93.38  30.46   
4   1  ARG B 143 ? ? -138.22 -38.35  
5   1  LEU B 144 ? ? 65.80   162.79  
6   1  LYS B 147 ? ? -106.70 49.17   
7   2  ARG A 43  ? ? -149.08 -37.19  
8   2  LEU A 44  ? ? 71.31   142.37  
9   2  PHE A 46  ? ? -102.04 -67.27  
10  2  LYS A 47  ? ? 69.94   -28.52  
11  2  ARG B 143 ? ? -150.07 -38.08  
12  2  LEU B 144 ? ? 66.84   146.66  
13  3  ARG A 43  ? ? -133.59 -47.09  
14  3  LEU A 44  ? ? 67.21   141.88  
15  3  THR A 49  ? ? -151.85 15.35   
16  3  ARG B 143 ? ? -134.18 -31.34  
17  3  LEU B 144 ? ? 65.17   162.00  
18  3  PHE B 146 ? ? -123.23 -69.79  
19  3  LYS B 147 ? ? 72.05   -30.94  
20  3  GLN B 148 ? ? 67.06   -83.31  
21  4  LEU A 44  ? ? 72.76   150.59  
22  4  PHE A 46  ? ? -104.46 -74.14  
23  4  LYS A 47  ? ? 73.09   -18.02  
24  4  GLN A 48  ? ? 53.97   -157.11 
25  4  ARG B 143 ? ? -152.97 -29.73  
26  4  LEU B 144 ? ? 66.92   160.92  
27  4  LYS B 147 ? ? -61.18  99.91   
28  5  ARG A 43  ? ? -146.80 -37.39  
29  5  LEU A 44  ? ? 70.32   137.38  
30  5  LYS A 47  ? ? -82.06  47.56   
31  5  THR A 49  ? ? 53.06   16.34   
32  5  ARG B 143 ? ? -143.67 -33.17  
33  5  LEU B 144 ? ? 73.31   150.12  
34  5  GLN B 148 ? ? 52.40   -96.39  
35  6  ARG A 43  ? ? -146.91 -42.23  
36  6  LEU A 44  ? ? 68.84   149.19  
37  6  PHE A 46  ? ? -138.44 -45.82  
38  6  ARG B 143 ? ? -145.76 -35.54  
39  6  LEU B 144 ? ? 65.91   143.37  
40  6  GLN B 148 ? ? -72.84  -166.29 
41  6  THR B 149 ? ? -142.32 28.36   
42  7  ARG A 43  ? ? -152.38 -33.06  
43  7  LEU A 44  ? ? 69.00   158.30  
44  7  ARG B 143 ? ? -149.89 -39.65  
45  7  LEU B 144 ? ? 67.33   145.16  
46  7  GLN B 148 ? ? 45.38   175.15  
47  8  ARG A 43  ? ? -154.04 -33.76  
48  8  LEU A 44  ? ? 71.76   148.09  
49  8  LYS A 47  ? ? 47.23   24.99   
50  8  GLN A 48  ? ? 54.83   -161.79 
51  8  THR A 49  ? ? -94.69  44.61   
52  8  ARG B 143 ? ? -153.77 -32.70  
53  8  LEU B 144 ? ? 72.84   151.41  
54  8  PHE B 146 ? ? -125.14 -76.19  
55  8  LYS B 147 ? ? 77.62   -18.91  
56  8  GLN B 148 ? ? 61.25   -98.12  
57  8  THR B 149 ? ? -161.68 -41.20  
58  9  ARG A 43  ? ? -154.56 -33.36  
59  9  LEU A 44  ? ? 72.61   152.15  
60  9  PHE A 46  ? ? -138.36 -52.16  
61  9  ARG B 143 ? ? -155.75 -37.08  
62  9  LEU B 144 ? ? 66.99   158.94  
63  9  GLN B 148 ? ? 53.23   -165.13 
64  9  THR B 149 ? ? -141.84 27.55   
65  10 ARG A 43  ? ? -148.31 -31.04  
66  10 LEU A 44  ? ? 64.16   170.37  
67  10 PHE A 46  ? ? -138.59 -41.56  
68  10 LYS A 47  ? ? 49.24   27.80   
69  10 ARG B 143 ? ? -153.68 -29.72  
70  10 LEU B 144 ? ? 70.69   167.00  
71  10 PHE B 146 ? ? -141.39 -50.11  
72  10 LYS B 147 ? ? 80.93   -28.60  
73  10 GLN B 148 ? ? 56.07   -99.51  
74  10 THR B 149 ? ? -172.21 -45.70  
75  11 ARG A 43  ? ? -142.28 -43.81  
76  11 LEU A 44  ? ? 69.36   139.24  
77  11 LYS A 47  ? ? -79.67  48.44   
78  11 ARG B 143 ? ? -148.02 -32.85  
79  11 LEU B 144 ? ? 66.42   155.51  
80  11 PHE B 146 ? ? -144.91 -38.28  
81  11 LYS B 147 ? ? 65.87   -90.50  
82  11 GLN B 148 ? ? 150.69  -176.71 
83  12 ARG A 43  ? ? -142.50 -41.21  
84  12 LEU A 44  ? ? 65.87   149.82  
85  12 LYS A 47  ? ? 46.80   28.82   
86  12 ARG B 143 ? ? -151.79 -26.86  
87  12 LEU B 144 ? ? 66.77   158.22  
88  12 PHE B 146 ? ? -141.91 -52.67  
89  12 GLN B 148 ? ? 60.47   -163.81 
90  13 ARG A 43  ? ? -143.64 -39.50  
91  13 LEU A 44  ? ? 67.50   145.78  
92  13 ARG B 143 ? ? -153.87 -37.99  
93  13 LEU B 144 ? ? 65.47   149.26  
94  13 PHE B 146 ? ? -137.96 -54.56  
95  13 THR B 149 ? ? -144.97 20.51   
96  14 ARG A 43  ? ? -147.46 -36.15  
97  14 LEU A 44  ? ? 68.00   148.99  
98  14 LYS A 47  ? ? -98.99  31.51   
99  14 THR A 49  ? ? -119.19 65.56   
100 14 ARG B 143 ? ? -145.09 -36.09  
101 14 LEU B 144 ? ? 69.77   148.61  
102 14 GLN B 148 ? ? 52.43   -162.29 
103 15 ARG A 43  ? ? -147.68 -35.32  
104 15 LEU A 44  ? ? 73.76   148.89  
105 15 LYS A 47  ? ? 39.16   40.15   
106 15 GLN A 48  ? ? -58.97  -170.92 
107 15 THR A 49  ? ? -160.83 27.90   
108 15 ARG B 143 ? ? -145.61 -25.62  
109 15 LEU B 144 ? ? 74.26   153.06  
110 15 PHE B 146 ? ? -136.97 -64.77  
111 16 ARG A 43  ? ? -145.16 -46.02  
112 16 LEU A 44  ? ? 66.81   152.16  
113 16 ARG B 143 ? ? -145.76 -39.18  
114 16 LEU B 144 ? ? 64.87   163.59  
115 17 ARG A 43  ? ? -149.92 -33.19  
116 17 LEU A 44  ? ? 69.65   152.78  
117 17 PHE A 46  ? ? -128.01 -66.28  
118 17 ARG B 143 ? ? -154.70 -33.07  
119 17 LEU B 144 ? ? 69.37   128.00  
120 17 GLN B 148 ? ? 56.83   167.36  
121 17 THR B 149 ? ? -152.76 71.56   
122 18 LEU A 44  ? ? 66.73   152.11  
123 18 PHE A 46  ? ? -127.35 -65.89  
124 18 LYS A 47  ? ? 72.13   61.56   
125 18 THR A 49  ? ? -143.50 -24.52  
126 18 ARG B 143 ? ? -137.05 -41.95  
127 18 LEU B 144 ? ? 65.51   153.44  
128 18 LYS B 147 ? ? 61.69   -27.12  
129 18 GLN B 148 ? ? 56.11   -75.49  
130 19 ARG A 43  ? ? -148.31 -33.05  
131 19 LEU A 44  ? ? 64.73   164.38  
132 19 LYS A 47  ? ? 39.19   35.62   
133 19 ARG B 143 ? ? -131.34 -45.62  
134 19 LEU B 144 ? ? 64.16   147.19  
135 19 PHE B 146 ? ? -147.49 -41.40  
136 19 LYS B 147 ? ? 66.95   -83.90  
137 19 GLN B 148 ? ? -126.68 -76.31  
138 19 THR B 149 ? ? -151.97 28.86   
139 20 ARG A 43  ? ? -147.87 -28.85  
140 20 LEU A 44  ? ? 68.69   141.17  
141 20 PHE A 46  ? ? -130.78 -64.81  
142 20 GLN A 48  ? ? 43.24   -76.03  
143 20 THR A 49  ? ? 175.50  -24.44  
144 20 ARG B 143 ? ? -149.73 -35.05  
145 20 LEU B 144 ? ? 67.30   148.67  
146 20 THR B 149 ? ? -160.49 74.02   
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2K29 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2K29 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.5-1.0 mM [U-100% 13C; U-100% 15N] RelBN, 20 mM sodium phosphate, 100 mM sodium chloride, 1 mM DTT, 1 uM sodium azide, 90% H2O/10% D2O
;
1 '90% H2O/10% D2O' 
'0.5-1.0 mM [U-100% 13C; U-100% 15N] RelBN, 20 mM sodium phosphate, 100 mM sodium chloride, 1 mM DTT, 1 uM sodium azide, 100% D2O' 
2 '100% D2O'        
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
RelBN              0.5 mM '[U-100% 13C; U-100% 15N]' 1 
'sodium phosphate' 20  mM ?                          1 
'sodium chloride'  100 mM ?                          1 
DTT                1   mM ?                          1 
'sodium azide'     1   uM ?                          1 
RelBN              0.5 mM '[U-100% 13C; U-100% 15N]' 2 
'sodium phosphate' 20  mM ?                          2 
'sodium chloride'  100 mM ?                          2 
DTT                1   mM ?                          2 
'sodium azide'     1   uM ?                          2 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.12 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '3D HNCACB'       
1 3  1 '3D CBCA(CO)NH'   
1 4  1 '3D C(CO)NH'      
1 5  1 '3D H(CCO)NH'     
1 6  1 '3D HNCO'         
1 7  2 '2D 1H-13C HSQC'  
1 8  2 '3D HCCH-TOCSY'   
1 9  1 '3D 1H-15N NOESY' 
1 10 1 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_details.entry_id   2K29 
_pdbx_nmr_details.text       'The structure was determined using a combination of NOE and residual dipolar coupling data.' 
# 
_pdbx_nmr_constraints.disulfide_bond_constraints_total_count        ? 
_pdbx_nmr_constraints.entry_id                                      2K29 
_pdbx_nmr_constraints.hydrogen_bond_constraints_total_count         104 
_pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_beta-angle_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_chi-angle_constraints_total_count          ? 
_pdbx_nmr_constraints.NA_delta-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count      ? 
_pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_other-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count       ? 
_pdbx_nmr_constraints.NOE_constraints_total                         2994 
_pdbx_nmr_constraints.NOE_interentity_total_count                   ? 
_pdbx_nmr_constraints.NOE_interproton_distance_evaluation           ? 
_pdbx_nmr_constraints.NOE_intraresidue_total_count                  708 
_pdbx_nmr_constraints.NOE_long_range_total_count                    712 
_pdbx_nmr_constraints.NOE_medium_range_total_count                  754 
_pdbx_nmr_constraints.NOE_motional_averaging_correction             ? 
_pdbx_nmr_constraints.NOE_pseudoatom_corrections                    ? 
_pdbx_nmr_constraints.NOE_sequential_total_count                    820 
_pdbx_nmr_constraints.protein_chi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_other_angle_constraints_total_count   ? 
_pdbx_nmr_constraints.protein_phi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_psi_angle_constraints_total_count     ? 
# 
_pdbx_nmr_refine.entry_id           2K29 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Guntert, Mumenthaler and Wuthrich'            'structure solution'        CYANA 2.1  1 
'Brunger, Adams, Clore, Gros, Nilges and Read' refinement                  CNS   1.1  2 
Varian                                         collection                  VNMR  6.1C 3 
'Bartels et al.'                               'chemical shift assignment' XEASY ?    4 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1  Y 1 A GLY -2  ? A GLY 1 
2   1  Y 1 A SER -1  ? A SER 2 
3   1  Y 1 A HIS 0   ? A HIS 3 
4   1  Y 1 B GLY 98  ? B GLY 1 
5   1  Y 1 B SER 99  ? B SER 2 
6   1  Y 1 B HIS 100 ? B HIS 3 
7   2  Y 1 A GLY -2  ? A GLY 1 
8   2  Y 1 A SER -1  ? A SER 2 
9   2  Y 1 A HIS 0   ? A HIS 3 
10  2  Y 1 B GLY 98  ? B GLY 1 
11  2  Y 1 B SER 99  ? B SER 2 
12  2  Y 1 B HIS 100 ? B HIS 3 
13  3  Y 1 A GLY -2  ? A GLY 1 
14  3  Y 1 A SER -1  ? A SER 2 
15  3  Y 1 A HIS 0   ? A HIS 3 
16  3  Y 1 B GLY 98  ? B GLY 1 
17  3  Y 1 B SER 99  ? B SER 2 
18  3  Y 1 B HIS 100 ? B HIS 3 
19  4  Y 1 A GLY -2  ? A GLY 1 
20  4  Y 1 A SER -1  ? A SER 2 
21  4  Y 1 A HIS 0   ? A HIS 3 
22  4  Y 1 B GLY 98  ? B GLY 1 
23  4  Y 1 B SER 99  ? B SER 2 
24  4  Y 1 B HIS 100 ? B HIS 3 
25  5  Y 1 A GLY -2  ? A GLY 1 
26  5  Y 1 A SER -1  ? A SER 2 
27  5  Y 1 A HIS 0   ? A HIS 3 
28  5  Y 1 B GLY 98  ? B GLY 1 
29  5  Y 1 B SER 99  ? B SER 2 
30  5  Y 1 B HIS 100 ? B HIS 3 
31  6  Y 1 A GLY -2  ? A GLY 1 
32  6  Y 1 A SER -1  ? A SER 2 
33  6  Y 1 A HIS 0   ? A HIS 3 
34  6  Y 1 B GLY 98  ? B GLY 1 
35  6  Y 1 B SER 99  ? B SER 2 
36  6  Y 1 B HIS 100 ? B HIS 3 
37  7  Y 1 A GLY -2  ? A GLY 1 
38  7  Y 1 A SER -1  ? A SER 2 
39  7  Y 1 A HIS 0   ? A HIS 3 
40  7  Y 1 B GLY 98  ? B GLY 1 
41  7  Y 1 B SER 99  ? B SER 2 
42  7  Y 1 B HIS 100 ? B HIS 3 
43  8  Y 1 A GLY -2  ? A GLY 1 
44  8  Y 1 A SER -1  ? A SER 2 
45  8  Y 1 A HIS 0   ? A HIS 3 
46  8  Y 1 B GLY 98  ? B GLY 1 
47  8  Y 1 B SER 99  ? B SER 2 
48  8  Y 1 B HIS 100 ? B HIS 3 
49  9  Y 1 A GLY -2  ? A GLY 1 
50  9  Y 1 A SER -1  ? A SER 2 
51  9  Y 1 A HIS 0   ? A HIS 3 
52  9  Y 1 B GLY 98  ? B GLY 1 
53  9  Y 1 B SER 99  ? B SER 2 
54  9  Y 1 B HIS 100 ? B HIS 3 
55  10 Y 1 A GLY -2  ? A GLY 1 
56  10 Y 1 A SER -1  ? A SER 2 
57  10 Y 1 A HIS 0   ? A HIS 3 
58  10 Y 1 B GLY 98  ? B GLY 1 
59  10 Y 1 B SER 99  ? B SER 2 
60  10 Y 1 B HIS 100 ? B HIS 3 
61  11 Y 1 A GLY -2  ? A GLY 1 
62  11 Y 1 A SER -1  ? A SER 2 
63  11 Y 1 A HIS 0   ? A HIS 3 
64  11 Y 1 B GLY 98  ? B GLY 1 
65  11 Y 1 B SER 99  ? B SER 2 
66  11 Y 1 B HIS 100 ? B HIS 3 
67  12 Y 1 A GLY -2  ? A GLY 1 
68  12 Y 1 A SER -1  ? A SER 2 
69  12 Y 1 A HIS 0   ? A HIS 3 
70  12 Y 1 B GLY 98  ? B GLY 1 
71  12 Y 1 B SER 99  ? B SER 2 
72  12 Y 1 B HIS 100 ? B HIS 3 
73  13 Y 1 A GLY -2  ? A GLY 1 
74  13 Y 1 A SER -1  ? A SER 2 
75  13 Y 1 A HIS 0   ? A HIS 3 
76  13 Y 1 B GLY 98  ? B GLY 1 
77  13 Y 1 B SER 99  ? B SER 2 
78  13 Y 1 B HIS 100 ? B HIS 3 
79  14 Y 1 A GLY -2  ? A GLY 1 
80  14 Y 1 A SER -1  ? A SER 2 
81  14 Y 1 A HIS 0   ? A HIS 3 
82  14 Y 1 B GLY 98  ? B GLY 1 
83  14 Y 1 B SER 99  ? B SER 2 
84  14 Y 1 B HIS 100 ? B HIS 3 
85  15 Y 1 A GLY -2  ? A GLY 1 
86  15 Y 1 A SER -1  ? A SER 2 
87  15 Y 1 A HIS 0   ? A HIS 3 
88  15 Y 1 B GLY 98  ? B GLY 1 
89  15 Y 1 B SER 99  ? B SER 2 
90  15 Y 1 B HIS 100 ? B HIS 3 
91  16 Y 1 A GLY -2  ? A GLY 1 
92  16 Y 1 A SER -1  ? A SER 2 
93  16 Y 1 A HIS 0   ? A HIS 3 
94  16 Y 1 B GLY 98  ? B GLY 1 
95  16 Y 1 B SER 99  ? B SER 2 
96  16 Y 1 B HIS 100 ? B HIS 3 
97  17 Y 1 A GLY -2  ? A GLY 1 
98  17 Y 1 A SER -1  ? A SER 2 
99  17 Y 1 A HIS 0   ? A HIS 3 
100 17 Y 1 B GLY 98  ? B GLY 1 
101 17 Y 1 B SER 99  ? B SER 2 
102 17 Y 1 B HIS 100 ? B HIS 3 
103 18 Y 1 A GLY -2  ? A GLY 1 
104 18 Y 1 A SER -1  ? A SER 2 
105 18 Y 1 A HIS 0   ? A HIS 3 
106 18 Y 1 B GLY 98  ? B GLY 1 
107 18 Y 1 B SER 99  ? B SER 2 
108 18 Y 1 B HIS 100 ? B HIS 3 
109 19 Y 1 A GLY -2  ? A GLY 1 
110 19 Y 1 A SER -1  ? A SER 2 
111 19 Y 1 A HIS 0   ? A HIS 3 
112 19 Y 1 B GLY 98  ? B GLY 1 
113 19 Y 1 B SER 99  ? B SER 2 
114 19 Y 1 B HIS 100 ? B HIS 3 
115 20 Y 1 A GLY -2  ? A GLY 1 
116 20 Y 1 A SER -1  ? A SER 2 
117 20 Y 1 A HIS 0   ? A HIS 3 
118 20 Y 1 B GLY 98  ? B GLY 1 
119 20 Y 1 B SER 99  ? B SER 2 
120 20 Y 1 B HIS 100 ? B HIS 3 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
HIS N    N N N 123 
HIS CA   C N S 124 
HIS C    C N N 125 
HIS O    O N N 126 
HIS CB   C N N 127 
HIS CG   C Y N 128 
HIS ND1  N Y N 129 
HIS CD2  C Y N 130 
HIS CE1  C Y N 131 
HIS NE2  N Y N 132 
HIS OXT  O N N 133 
HIS H    H N N 134 
HIS H2   H N N 135 
HIS HA   H N N 136 
HIS HB2  H N N 137 
HIS HB3  H N N 138 
HIS HD1  H N N 139 
HIS HD2  H N N 140 
HIS HE1  H N N 141 
HIS HE2  H N N 142 
HIS HXT  H N N 143 
ILE N    N N N 144 
ILE CA   C N S 145 
ILE C    C N N 146 
ILE O    O N N 147 
ILE CB   C N S 148 
ILE CG1  C N N 149 
ILE CG2  C N N 150 
ILE CD1  C N N 151 
ILE OXT  O N N 152 
ILE H    H N N 153 
ILE H2   H N N 154 
ILE HA   H N N 155 
ILE HB   H N N 156 
ILE HG12 H N N 157 
ILE HG13 H N N 158 
ILE HG21 H N N 159 
ILE HG22 H N N 160 
ILE HG23 H N N 161 
ILE HD11 H N N 162 
ILE HD12 H N N 163 
ILE HD13 H N N 164 
ILE HXT  H N N 165 
LEU N    N N N 166 
LEU CA   C N S 167 
LEU C    C N N 168 
LEU O    O N N 169 
LEU CB   C N N 170 
LEU CG   C N N 171 
LEU CD1  C N N 172 
LEU CD2  C N N 173 
LEU OXT  O N N 174 
LEU H    H N N 175 
LEU H2   H N N 176 
LEU HA   H N N 177 
LEU HB2  H N N 178 
LEU HB3  H N N 179 
LEU HG   H N N 180 
LEU HD11 H N N 181 
LEU HD12 H N N 182 
LEU HD13 H N N 183 
LEU HD21 H N N 184 
LEU HD22 H N N 185 
LEU HD23 H N N 186 
LEU HXT  H N N 187 
LYS N    N N N 188 
LYS CA   C N S 189 
LYS C    C N N 190 
LYS O    O N N 191 
LYS CB   C N N 192 
LYS CG   C N N 193 
LYS CD   C N N 194 
LYS CE   C N N 195 
LYS NZ   N N N 196 
LYS OXT  O N N 197 
LYS H    H N N 198 
LYS H2   H N N 199 
LYS HA   H N N 200 
LYS HB2  H N N 201 
LYS HB3  H N N 202 
LYS HG2  H N N 203 
LYS HG3  H N N 204 
LYS HD2  H N N 205 
LYS HD3  H N N 206 
LYS HE2  H N N 207 
LYS HE3  H N N 208 
LYS HZ1  H N N 209 
LYS HZ2  H N N 210 
LYS HZ3  H N N 211 
LYS HXT  H N N 212 
MET N    N N N 213 
MET CA   C N S 214 
MET C    C N N 215 
MET O    O N N 216 
MET CB   C N N 217 
MET CG   C N N 218 
MET SD   S N N 219 
MET CE   C N N 220 
MET OXT  O N N 221 
MET H    H N N 222 
MET H2   H N N 223 
MET HA   H N N 224 
MET HB2  H N N 225 
MET HB3  H N N 226 
MET HG2  H N N 227 
MET HG3  H N N 228 
MET HE1  H N N 229 
MET HE2  H N N 230 
MET HE3  H N N 231 
MET HXT  H N N 232 
PHE N    N N N 233 
PHE CA   C N S 234 
PHE C    C N N 235 
PHE O    O N N 236 
PHE CB   C N N 237 
PHE CG   C Y N 238 
PHE CD1  C Y N 239 
PHE CD2  C Y N 240 
PHE CE1  C Y N 241 
PHE CE2  C Y N 242 
PHE CZ   C Y N 243 
PHE OXT  O N N 244 
PHE H    H N N 245 
PHE H2   H N N 246 
PHE HA   H N N 247 
PHE HB2  H N N 248 
PHE HB3  H N N 249 
PHE HD1  H N N 250 
PHE HD2  H N N 251 
PHE HE1  H N N 252 
PHE HE2  H N N 253 
PHE HZ   H N N 254 
PHE HXT  H N N 255 
PRO N    N N N 256 
PRO CA   C N S 257 
PRO C    C N N 258 
PRO O    O N N 259 
PRO CB   C N N 260 
PRO CG   C N N 261 
PRO CD   C N N 262 
PRO OXT  O N N 263 
PRO H    H N N 264 
PRO HA   H N N 265 
PRO HB2  H N N 266 
PRO HB3  H N N 267 
PRO HG2  H N N 268 
PRO HG3  H N N 269 
PRO HD2  H N N 270 
PRO HD3  H N N 271 
PRO HXT  H N N 272 
SER N    N N N 273 
SER CA   C N S 274 
SER C    C N N 275 
SER O    O N N 276 
SER CB   C N N 277 
SER OG   O N N 278 
SER OXT  O N N 279 
SER H    H N N 280 
SER H2   H N N 281 
SER HA   H N N 282 
SER HB2  H N N 283 
SER HB3  H N N 284 
SER HG   H N N 285 
SER HXT  H N N 286 
THR N    N N N 287 
THR CA   C N S 288 
THR C    C N N 289 
THR O    O N N 290 
THR CB   C N R 291 
THR OG1  O N N 292 
THR CG2  C N N 293 
THR OXT  O N N 294 
THR H    H N N 295 
THR H2   H N N 296 
THR HA   H N N 297 
THR HB   H N N 298 
THR HG1  H N N 299 
THR HG21 H N N 300 
THR HG22 H N N 301 
THR HG23 H N N 302 
THR HXT  H N N 303 
TYR N    N N N 304 
TYR CA   C N S 305 
TYR C    C N N 306 
TYR O    O N N 307 
TYR CB   C N N 308 
TYR CG   C Y N 309 
TYR CD1  C Y N 310 
TYR CD2  C Y N 311 
TYR CE1  C Y N 312 
TYR CE2  C Y N 313 
TYR CZ   C Y N 314 
TYR OH   O N N 315 
TYR OXT  O N N 316 
TYR H    H N N 317 
TYR H2   H N N 318 
TYR HA   H N N 319 
TYR HB2  H N N 320 
TYR HB3  H N N 321 
TYR HD1  H N N 322 
TYR HD2  H N N 323 
TYR HE1  H N N 324 
TYR HE2  H N N 325 
TYR HH   H N N 326 
TYR HXT  H N N 327 
VAL N    N N N 328 
VAL CA   C N S 329 
VAL C    C N N 330 
VAL O    O N N 331 
VAL CB   C N N 332 
VAL CG1  C N N 333 
VAL CG2  C N N 334 
VAL OXT  O N N 335 
VAL H    H N N 336 
VAL H2   H N N 337 
VAL HA   H N N 338 
VAL HB   H N N 339 
VAL HG11 H N N 340 
VAL HG12 H N N 341 
VAL HG13 H N N 342 
VAL HG21 H N N 343 
VAL HG22 H N N 344 
VAL HG23 H N N 345 
VAL HXT  H N N 346 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
ILE N   CA   sing N N 137 
ILE N   H    sing N N 138 
ILE N   H2   sing N N 139 
ILE CA  C    sing N N 140 
ILE CA  CB   sing N N 141 
ILE CA  HA   sing N N 142 
ILE C   O    doub N N 143 
ILE C   OXT  sing N N 144 
ILE CB  CG1  sing N N 145 
ILE CB  CG2  sing N N 146 
ILE CB  HB   sing N N 147 
ILE CG1 CD1  sing N N 148 
ILE CG1 HG12 sing N N 149 
ILE CG1 HG13 sing N N 150 
ILE CG2 HG21 sing N N 151 
ILE CG2 HG22 sing N N 152 
ILE CG2 HG23 sing N N 153 
ILE CD1 HD11 sing N N 154 
ILE CD1 HD12 sing N N 155 
ILE CD1 HD13 sing N N 156 
ILE OXT HXT  sing N N 157 
LEU N   CA   sing N N 158 
LEU N   H    sing N N 159 
LEU N   H2   sing N N 160 
LEU CA  C    sing N N 161 
LEU CA  CB   sing N N 162 
LEU CA  HA   sing N N 163 
LEU C   O    doub N N 164 
LEU C   OXT  sing N N 165 
LEU CB  CG   sing N N 166 
LEU CB  HB2  sing N N 167 
LEU CB  HB3  sing N N 168 
LEU CG  CD1  sing N N 169 
LEU CG  CD2  sing N N 170 
LEU CG  HG   sing N N 171 
LEU CD1 HD11 sing N N 172 
LEU CD1 HD12 sing N N 173 
LEU CD1 HD13 sing N N 174 
LEU CD2 HD21 sing N N 175 
LEU CD2 HD22 sing N N 176 
LEU CD2 HD23 sing N N 177 
LEU OXT HXT  sing N N 178 
LYS N   CA   sing N N 179 
LYS N   H    sing N N 180 
LYS N   H2   sing N N 181 
LYS CA  C    sing N N 182 
LYS CA  CB   sing N N 183 
LYS CA  HA   sing N N 184 
LYS C   O    doub N N 185 
LYS C   OXT  sing N N 186 
LYS CB  CG   sing N N 187 
LYS CB  HB2  sing N N 188 
LYS CB  HB3  sing N N 189 
LYS CG  CD   sing N N 190 
LYS CG  HG2  sing N N 191 
LYS CG  HG3  sing N N 192 
LYS CD  CE   sing N N 193 
LYS CD  HD2  sing N N 194 
LYS CD  HD3  sing N N 195 
LYS CE  NZ   sing N N 196 
LYS CE  HE2  sing N N 197 
LYS CE  HE3  sing N N 198 
LYS NZ  HZ1  sing N N 199 
LYS NZ  HZ2  sing N N 200 
LYS NZ  HZ3  sing N N 201 
LYS OXT HXT  sing N N 202 
MET N   CA   sing N N 203 
MET N   H    sing N N 204 
MET N   H2   sing N N 205 
MET CA  C    sing N N 206 
MET CA  CB   sing N N 207 
MET CA  HA   sing N N 208 
MET C   O    doub N N 209 
MET C   OXT  sing N N 210 
MET CB  CG   sing N N 211 
MET CB  HB2  sing N N 212 
MET CB  HB3  sing N N 213 
MET CG  SD   sing N N 214 
MET CG  HG2  sing N N 215 
MET CG  HG3  sing N N 216 
MET SD  CE   sing N N 217 
MET CE  HE1  sing N N 218 
MET CE  HE2  sing N N 219 
MET CE  HE3  sing N N 220 
MET OXT HXT  sing N N 221 
PHE N   CA   sing N N 222 
PHE N   H    sing N N 223 
PHE N   H2   sing N N 224 
PHE CA  C    sing N N 225 
PHE CA  CB   sing N N 226 
PHE CA  HA   sing N N 227 
PHE C   O    doub N N 228 
PHE C   OXT  sing N N 229 
PHE CB  CG   sing N N 230 
PHE CB  HB2  sing N N 231 
PHE CB  HB3  sing N N 232 
PHE CG  CD1  doub Y N 233 
PHE CG  CD2  sing Y N 234 
PHE CD1 CE1  sing Y N 235 
PHE CD1 HD1  sing N N 236 
PHE CD2 CE2  doub Y N 237 
PHE CD2 HD2  sing N N 238 
PHE CE1 CZ   doub Y N 239 
PHE CE1 HE1  sing N N 240 
PHE CE2 CZ   sing Y N 241 
PHE CE2 HE2  sing N N 242 
PHE CZ  HZ   sing N N 243 
PHE OXT HXT  sing N N 244 
PRO N   CA   sing N N 245 
PRO N   CD   sing N N 246 
PRO N   H    sing N N 247 
PRO CA  C    sing N N 248 
PRO CA  CB   sing N N 249 
PRO CA  HA   sing N N 250 
PRO C   O    doub N N 251 
PRO C   OXT  sing N N 252 
PRO CB  CG   sing N N 253 
PRO CB  HB2  sing N N 254 
PRO CB  HB3  sing N N 255 
PRO CG  CD   sing N N 256 
PRO CG  HG2  sing N N 257 
PRO CG  HG3  sing N N 258 
PRO CD  HD2  sing N N 259 
PRO CD  HD3  sing N N 260 
PRO OXT HXT  sing N N 261 
SER N   CA   sing N N 262 
SER N   H    sing N N 263 
SER N   H2   sing N N 264 
SER CA  C    sing N N 265 
SER CA  CB   sing N N 266 
SER CA  HA   sing N N 267 
SER C   O    doub N N 268 
SER C   OXT  sing N N 269 
SER CB  OG   sing N N 270 
SER CB  HB2  sing N N 271 
SER CB  HB3  sing N N 272 
SER OG  HG   sing N N 273 
SER OXT HXT  sing N N 274 
THR N   CA   sing N N 275 
THR N   H    sing N N 276 
THR N   H2   sing N N 277 
THR CA  C    sing N N 278 
THR CA  CB   sing N N 279 
THR CA  HA   sing N N 280 
THR C   O    doub N N 281 
THR C   OXT  sing N N 282 
THR CB  OG1  sing N N 283 
THR CB  CG2  sing N N 284 
THR CB  HB   sing N N 285 
THR OG1 HG1  sing N N 286 
THR CG2 HG21 sing N N 287 
THR CG2 HG22 sing N N 288 
THR CG2 HG23 sing N N 289 
THR OXT HXT  sing N N 290 
TYR N   CA   sing N N 291 
TYR N   H    sing N N 292 
TYR N   H2   sing N N 293 
TYR CA  C    sing N N 294 
TYR CA  CB   sing N N 295 
TYR CA  HA   sing N N 296 
TYR C   O    doub N N 297 
TYR C   OXT  sing N N 298 
TYR CB  CG   sing N N 299 
TYR CB  HB2  sing N N 300 
TYR CB  HB3  sing N N 301 
TYR CG  CD1  doub Y N 302 
TYR CG  CD2  sing Y N 303 
TYR CD1 CE1  sing Y N 304 
TYR CD1 HD1  sing N N 305 
TYR CD2 CE2  doub Y N 306 
TYR CD2 HD2  sing N N 307 
TYR CE1 CZ   doub Y N 308 
TYR CE1 HE1  sing N N 309 
TYR CE2 CZ   sing Y N 310 
TYR CE2 HE2  sing N N 311 
TYR CZ  OH   sing N N 312 
TYR OH  HH   sing N N 313 
TYR OXT HXT  sing N N 314 
VAL N   CA   sing N N 315 
VAL N   H    sing N N 316 
VAL N   H2   sing N N 317 
VAL CA  C    sing N N 318 
VAL CA  CB   sing N N 319 
VAL CA  HA   sing N N 320 
VAL C   O    doub N N 321 
VAL C   OXT  sing N N 322 
VAL CB  CG1  sing N N 323 
VAL CB  CG2  sing N N 324 
VAL CB  HB   sing N N 325 
VAL CG1 HG11 sing N N 326 
VAL CG1 HG12 sing N N 327 
VAL CG1 HG13 sing N N 328 
VAL CG2 HG21 sing N N 329 
VAL CG2 HG22 sing N N 330 
VAL CG2 HG23 sing N N 331 
VAL OXT HXT  sing N N 332 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Varian INOVA 1 'Varian INOVA' 
500 Varian INOVA 2 'Varian INOVA' 
# 
_atom_sites.entry_id                    2K29 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_