data_2K2T # _entry.id 2K2T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K2T pdb_00002k2t 10.2210/pdb2k2t/pdb RCSB RCSB100604 ? ? WWPDB D_1000100604 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details BMRB 15682 unspecified . PDB 2K2S unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K2T _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-04-11 _pdbx_database_status.SG_entry . _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sawmynaden, K.' 1 'Saouros, S.' 2 'Marchant, J.' 3 'Simpson, P.' 4 'Matthews, S.' 5 # _citation.id primary _citation.title 'Structural insights into microneme protein assembly reveal a new mode of EGF domain recognition.' _citation.journal_abbrev 'Embo Rep.' _citation.journal_volume 9 _citation.page_first 1149 _citation.page_last 1155 _citation.year 2008 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1469-221X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18818666 _citation.pdbx_database_id_DOI 10.1038/embor.2008.179 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sawmynaden, K.' 1 ? primary 'Saouros, S.' 2 ? primary 'Friedrich, N.' 3 ? primary 'Marchant, J.' 4 ? primary 'Simpson, P.' 5 ? primary 'Bleijlevens, B.' 6 ? primary 'Blackman, M.J.' 7 ? primary 'Soldati-Favre, D.' 8 ? primary 'Matthews, S.' 9 ? # _cell.entry_id 2K2T _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2K2T _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Micronemal protein 6' _entity.formula_weight 6366.056 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'EGF2-like domain 2 (UNP residues 87-147)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MANFVQLSETPAACSSNPCGPEAAGTCKETNSGYICRCNQGYRISLDGTGNVTCIVRQESG _entity_poly.pdbx_seq_one_letter_code_can MANFVQLSETPAACSSNPCGPEAAGTCKETNSGYICRCNQGYRISLDGTGNVTCIVRQESG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ASN n 1 4 PHE n 1 5 VAL n 1 6 GLN n 1 7 LEU n 1 8 SER n 1 9 GLU n 1 10 THR n 1 11 PRO n 1 12 ALA n 1 13 ALA n 1 14 CYS n 1 15 SER n 1 16 SER n 1 17 ASN n 1 18 PRO n 1 19 CYS n 1 20 GLY n 1 21 PRO n 1 22 GLU n 1 23 ALA n 1 24 ALA n 1 25 GLY n 1 26 THR n 1 27 CYS n 1 28 LYS n 1 29 GLU n 1 30 THR n 1 31 ASN n 1 32 SER n 1 33 GLY n 1 34 TYR n 1 35 ILE n 1 36 CYS n 1 37 ARG n 1 38 CYS n 1 39 ASN n 1 40 GLN n 1 41 GLY n 1 42 TYR n 1 43 ARG n 1 44 ILE n 1 45 SER n 1 46 LEU n 1 47 ASP n 1 48 GLY n 1 49 THR n 1 50 GLY n 1 51 ASN n 1 52 VAL n 1 53 THR n 1 54 CYS n 1 55 ILE n 1 56 VAL n 1 57 ARG n 1 58 GLN n 1 59 GLU n 1 60 SER n 1 61 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MIC6 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Toxoplasma gondii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET32Xa/LIC _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MIC6_TOXGO _struct_ref.pdbx_db_accession Q9XYH7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MANFVQLSETPAACSSNPCGPEAAGTCKETNSGYICRCNQGYRISLDGTGNVTCIVRQESG _struct_ref.pdbx_align_begin 87 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K2T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 61 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9XYH7 _struct_ref_seq.db_align_beg 87 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 147 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 61 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCACB' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HN(CA)CO' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D HBHA(CO)NH' 1 8 1 '3D HC(CO)NH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.5 mM [U-98% 13C; U-98% 15N] Epidermal Growth Factor-like domain 2, 25 mM potassium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2K2T _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K2T _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K2T _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Johnson, One Moon Scientific' 'peak picking' NMRView . 1 ? refinement CNS . 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K2T _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K2T _struct.title 'Epidermal growth Factor-like domain 2 from Toxoplasma gondii Microneme protein 6' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K2T _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text ;EGF, MIC6, Toxoplasma gondii, apicomplexa, protozoa, Cell adhesion, Cytoplasmic vesicle, EGF-like domain, Membrane, Transmembrane, Virulence ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 13 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 17 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 13 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 17 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 14 A CYS 27 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 19 A CYS 36 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf3 disulf ? ? A CYS 38 SG ? ? ? 1_555 A CYS 54 SG ? ? A CYS 38 A CYS 54 1_555 ? ? ? ? ? ? ? 2.030 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 25 ? LYS A 28 ? GLY A 25 LYS A 28 A 2 ILE A 35 ? CYS A 38 ? ILE A 35 CYS A 38 B 1 TYR A 42 ? LEU A 46 ? TYR A 42 LEU A 46 B 2 VAL A 52 ? VAL A 56 ? VAL A 52 VAL A 56 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 26 ? N THR A 26 O ARG A 37 ? O ARG A 37 B 1 2 N ARG A 43 ? N ARG A 43 O ILE A 55 ? O ILE A 55 # _atom_sites.entry_id 2K2T _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ASN 3 3 ? ? ? A . n A 1 4 PHE 4 4 ? ? ? A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 GLY 61 61 61 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-02-24 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Epidermal Growth Factor-like domain 2' 0.5 mM '[U-98% 13C; U-98% 15N]' 1 'potassium phosphate' 25 mM ? 1 'sodium chloride' 50 mM ? 1 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 5 _pdbx_validate_close_contact.auth_atom_id_1 H _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLN _pdbx_validate_close_contact.auth_seq_id_1 6 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 29 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 8 ? ? -162.62 -72.05 2 1 ALA A 12 ? ? 68.09 123.78 3 1 ALA A 13 ? ? 69.57 -56.67 4 1 GLN A 58 ? ? -177.79 -71.73 5 1 GLU A 59 ? ? -138.72 -73.83 6 2 GLU A 9 ? ? -81.74 -92.49 7 2 PRO A 18 ? ? -78.85 -75.08 8 2 CYS A 19 ? ? -78.45 24.05 9 2 ARG A 57 ? ? -76.49 -75.80 10 2 GLU A 59 ? ? 178.38 86.23 11 3 LEU A 7 ? ? 62.33 -177.64 12 3 ALA A 12 ? ? 43.56 -93.04 13 4 LEU A 7 ? ? -81.99 -87.53 14 4 SER A 8 ? ? -147.11 -67.07 15 4 PRO A 11 ? ? -78.00 29.39 16 4 ALA A 12 ? ? 50.98 -99.72 17 4 ASN A 17 ? ? 54.03 72.59 18 4 ASN A 31 ? ? -79.82 46.83 19 4 SER A 32 ? ? -162.90 -41.43 20 5 SER A 8 ? ? -69.51 -72.52 21 5 GLU A 9 ? ? -98.92 -88.92 22 5 ALA A 12 ? ? 43.65 -87.44 23 5 ASN A 17 ? ? 55.95 73.29 24 6 GLU A 9 ? ? -93.71 -79.70 25 6 PRO A 11 ? ? -76.78 -163.05 26 6 ALA A 12 ? ? -103.89 -65.43 27 6 ASN A 17 ? ? 62.29 73.04 28 6 GLN A 58 ? ? -165.77 -72.73 29 7 GLN A 6 ? ? -177.59 -48.07 30 7 LEU A 7 ? ? 69.88 -95.69 31 7 SER A 8 ? ? -154.51 -82.05 32 7 ASN A 17 ? ? 57.50 76.37 33 7 PRO A 18 ? ? -73.23 -73.02 34 7 GLU A 59 ? ? -105.19 67.29 35 7 SER A 60 ? ? -127.03 -52.41 36 8 ALA A 12 ? ? 66.90 121.19 37 8 ALA A 13 ? ? 70.68 -58.37 38 8 ALA A 24 ? ? -94.61 -63.61 39 8 GLN A 58 ? ? -150.44 -65.45 40 8 GLU A 59 ? ? -174.96 100.56 41 9 SER A 8 ? ? 72.11 -62.52 42 9 GLU A 9 ? ? -132.44 -63.95 43 9 PRO A 11 ? ? -72.47 29.04 44 9 ALA A 12 ? ? 43.63 -96.01 45 9 ASN A 17 ? ? 55.79 84.54 46 9 GLN A 58 ? ? -177.74 89.59 47 9 SER A 60 ? ? 68.53 161.09 48 10 LEU A 7 ? ? 69.53 167.26 49 10 GLU A 9 ? ? -142.12 -76.42 50 10 PRO A 11 ? ? -71.50 20.39 51 10 ALA A 12 ? ? 48.73 -94.52 52 10 GLN A 58 ? ? 172.53 127.82 53 10 GLU A 59 ? ? 65.66 -175.43 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ASN 3 ? A ASN 3 4 1 Y 1 A PHE 4 ? A PHE 4 5 2 Y 1 A MET 1 ? A MET 1 6 2 Y 1 A ALA 2 ? A ALA 2 7 2 Y 1 A ASN 3 ? A ASN 3 8 2 Y 1 A PHE 4 ? A PHE 4 9 3 Y 1 A MET 1 ? A MET 1 10 3 Y 1 A ALA 2 ? A ALA 2 11 3 Y 1 A ASN 3 ? A ASN 3 12 3 Y 1 A PHE 4 ? A PHE 4 13 4 Y 1 A MET 1 ? A MET 1 14 4 Y 1 A ALA 2 ? A ALA 2 15 4 Y 1 A ASN 3 ? A ASN 3 16 4 Y 1 A PHE 4 ? A PHE 4 17 5 Y 1 A MET 1 ? A MET 1 18 5 Y 1 A ALA 2 ? A ALA 2 19 5 Y 1 A ASN 3 ? A ASN 3 20 5 Y 1 A PHE 4 ? A PHE 4 21 6 Y 1 A MET 1 ? A MET 1 22 6 Y 1 A ALA 2 ? A ALA 2 23 6 Y 1 A ASN 3 ? A ASN 3 24 6 Y 1 A PHE 4 ? A PHE 4 25 7 Y 1 A MET 1 ? A MET 1 26 7 Y 1 A ALA 2 ? A ALA 2 27 7 Y 1 A ASN 3 ? A ASN 3 28 7 Y 1 A PHE 4 ? A PHE 4 29 8 Y 1 A MET 1 ? A MET 1 30 8 Y 1 A ALA 2 ? A ALA 2 31 8 Y 1 A ASN 3 ? A ASN 3 32 8 Y 1 A PHE 4 ? A PHE 4 33 9 Y 1 A MET 1 ? A MET 1 34 9 Y 1 A ALA 2 ? A ALA 2 35 9 Y 1 A ASN 3 ? A ASN 3 36 9 Y 1 A PHE 4 ? A PHE 4 37 10 Y 1 A MET 1 ? A MET 1 38 10 Y 1 A ALA 2 ? A ALA 2 39 10 Y 1 A ASN 3 ? A ASN 3 40 10 Y 1 A PHE 4 ? A PHE 4 #