data_2K2U # _entry.id 2K2U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K2U pdb_00002k2u 10.2210/pdb2k2u/pdb RCSB RCSB100605 ? ? WWPDB D_1000100605 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-08-12 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-10-20 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K2U _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-04-11 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Langlois, C.' 1 'Mas, C.' 2 'Di Lello, P.' 3 'Miller Jenkins, P.M.' 4 'Legault, J.' 5 'Omichinski, J.G.' 6 # _citation.id primary _citation.title ;NMR Structure of the Complex between the Tfb1 Subunit of TFIIH and the Activation Domain of VP16: Structural Similarities between VP16 and p53. ; _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 130 _citation.page_first 10596 _citation.page_last 10604 _citation.year 2008 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18630911 _citation.pdbx_database_id_DOI 10.1021/ja800975h # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Langlois, C.' 1 ? primary 'Mas, C.' 2 ? primary 'Di Lello, P.' 3 ? primary 'Jenkins, L.M.' 4 ? primary 'Legault, P.' 5 ? primary 'Omichinski, J.G.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RNA polymerase II transcription factor B subunit 1' 12903.701 1 ? ? 'PH domain' ? 2 polymer man 'Alpha trans-inducing protein' 3817.064 1 ? ? 'Transcription activation domain 2' ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 ;RNA polymerase II transcription factor B p73 subunit, RNA polymerase II transcription factor B 73 kDa subunit, General transcription and DNA repair factor IIH subunit TFB1, TFIIH subunit TFB1 ; 2 'Vmw65, ICP25, VP16 protein, Alpha-TIF' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEV VPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD ; ;PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEV VPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD ; A ? 2 'polypeptide(L)' no no GFTPHDSAPYGALDMADFEFEQMFTDALGIDEYGG GFTPHDSAPYGALDMADFEFEQMFTDALGIDEYGG B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 SER n 1 3 HIS n 1 4 SER n 1 5 GLY n 1 6 ALA n 1 7 ALA n 1 8 ILE n 1 9 PHE n 1 10 GLU n 1 11 LYS n 1 12 VAL n 1 13 SER n 1 14 GLY n 1 15 ILE n 1 16 ILE n 1 17 ALA n 1 18 ILE n 1 19 ASN n 1 20 GLU n 1 21 ASP n 1 22 VAL n 1 23 SER n 1 24 PRO n 1 25 ALA n 1 26 GLU n 1 27 LEU n 1 28 THR n 1 29 TRP n 1 30 ARG n 1 31 SER n 1 32 THR n 1 33 ASP n 1 34 GLY n 1 35 ASP n 1 36 LYS n 1 37 VAL n 1 38 HIS n 1 39 THR n 1 40 VAL n 1 41 VAL n 1 42 LEU n 1 43 SER n 1 44 THR n 1 45 ILE n 1 46 ASP n 1 47 LYS n 1 48 LEU n 1 49 GLN n 1 50 ALA n 1 51 THR n 1 52 PRO n 1 53 ALA n 1 54 SER n 1 55 SER n 1 56 GLU n 1 57 LYS n 1 58 MET n 1 59 MET n 1 60 LEU n 1 61 ARG n 1 62 LEU n 1 63 ILE n 1 64 GLY n 1 65 LYS n 1 66 VAL n 1 67 ASP n 1 68 GLU n 1 69 SER n 1 70 LYS n 1 71 LYS n 1 72 ARG n 1 73 LYS n 1 74 ASP n 1 75 ASN n 1 76 GLU n 1 77 GLY n 1 78 ASN n 1 79 GLU n 1 80 VAL n 1 81 VAL n 1 82 PRO n 1 83 LYS n 1 84 PRO n 1 85 GLN n 1 86 ARG n 1 87 HIS n 1 88 MET n 1 89 PHE n 1 90 SER n 1 91 PHE n 1 92 ASN n 1 93 ASN n 1 94 ARG n 1 95 THR n 1 96 VAL n 1 97 MET n 1 98 ASP n 1 99 ASN n 1 100 ILE n 1 101 LYS n 1 102 MET n 1 103 THR n 1 104 LEU n 1 105 GLN n 1 106 GLN n 1 107 ILE n 1 108 ILE n 1 109 SER n 1 110 ARG n 1 111 TYR n 1 112 LYS n 1 113 ASP n 1 114 ALA n 1 115 ASP n 2 1 GLY n 2 2 PHE n 2 3 THR n 2 4 PRO n 2 5 HIS n 2 6 ASP n 2 7 SER n 2 8 ALA n 2 9 PRO n 2 10 TYR n 2 11 GLY n 2 12 ALA n 2 13 LEU n 2 14 ASP n 2 15 MET n 2 16 ALA n 2 17 ASP n 2 18 PHE n 2 19 GLU n 2 20 PHE n 2 21 GLU n 2 22 GLN n 2 23 MET n 2 24 PHE n 2 25 THR n 2 26 ASP n 2 27 ALA n 2 28 LEU n 2 29 GLY n 2 30 ILE n 2 31 ASP n 2 32 GLU n 2 33 TYR n 2 34 GLY n 2 35 GLY n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? ;Baker's yeast ; Saccharomyces 'TFB1, YDR311W, D9740.3' Cerevisiae ? ? ? ? ? 'Saccharomyces cerevisiae' ? ? ? ? ? ? ? ? ? 'Escherichia coli' ? Escherichia ? ? coli ? ? TOPP2 ? ? ? ? ? ? ? pGEX-2T ? ? ? plasmid ? ? 2 1 sample ? ? ? HHV-1 ? UL48 ? 'strain F' ? ? ? ? 'Human herpesvirus 1' ? ? ? ? ? ? ? ? ? 'Escherichia coli' ? Escherichia ? ? coli ? ? TOPP2 ? ? ? ? ? ? ? pGEX-2T ? ? ? plasmid ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 ASP 115 115 115 ASP ASP A . n B 2 1 GLY 1 456 456 GLY GLY B . n B 2 2 PHE 2 457 457 PHE PHE B . n B 2 3 THR 3 458 458 THR THR B . n B 2 4 PRO 4 459 459 PRO PRO B . n B 2 5 HIS 5 460 460 HIS HIS B . n B 2 6 ASP 6 461 461 ASP ASP B . n B 2 7 SER 7 462 462 SER SER B . n B 2 8 ALA 8 463 463 ALA ALA B . n B 2 9 PRO 9 464 464 PRO PRO B . n B 2 10 TYR 10 465 465 TYR TYR B . n B 2 11 GLY 11 466 466 GLY GLY B . n B 2 12 ALA 12 467 467 ALA ALA B . n B 2 13 LEU 13 468 468 LEU LEU B . n B 2 14 ASP 14 469 469 ASP ASP B . n B 2 15 MET 15 470 470 MET MET B . n B 2 16 ALA 16 471 471 ALA ALA B . n B 2 17 ASP 17 472 472 ASP ASP B . n B 2 18 PHE 18 473 473 PHE PHE B . n B 2 19 GLU 19 474 474 GLU GLU B . n B 2 20 PHE 20 475 475 PHE PHE B . n B 2 21 GLU 21 476 476 GLU GLU B . n B 2 22 GLN 22 477 477 GLN GLN B . n B 2 23 MET 23 478 478 MET MET B . n B 2 24 PHE 24 479 479 PHE PHE B . n B 2 25 THR 25 480 480 THR THR B . n B 2 26 ASP 26 481 481 ASP ASP B . n B 2 27 ALA 27 482 482 ALA ALA B . n B 2 28 LEU 28 483 483 LEU LEU B . n B 2 29 GLY 29 484 484 GLY GLY B . n B 2 30 ILE 30 485 485 ILE ILE B . n B 2 31 ASP 31 486 486 ASP ASP B . n B 2 32 GLU 32 487 487 GLU GLU B . n B 2 33 TYR 33 488 488 TYR TYR B . n B 2 34 GLY 34 489 489 GLY GLY B . n B 2 35 GLY 35 490 490 GLY GLY B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K2U _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K2U _struct.title 'NMR Structure of the complex between Tfb1 subunit of TFIIH and the activation domain of VP16' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K2U _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;VP16, TFIIH, Tfb1, Activation, Transcription, PH Domain, Protein Structure Complex, DNA damage, DNA repair, Nucleus, Transcription regulation, DNA-binding ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP TFB1_YEAST P32776 1 ;MSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEV VPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD ; 1 ? 2 UNP ATIN_HHV1F P04486 2 GFTPHDSAPYGALDMADFEFEQMFTDALGIDEYGG 445 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2K2U A 1 ? 115 ? P32776 1 ? 115 ? 1 115 2 2 2K2U B 1 ? 35 ? P04486 445 ? 479 ? 456 490 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2K2U _struct_ref_seq_dif.mon_id PRO _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P32776 _struct_ref_seq_dif.db_mon_id MET _struct_ref_seq_dif.pdbx_seq_db_seq_num 1 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 93 ? ASP A 115 ? ASN A 93 ASP A 115 1 ? 23 HELX_P HELX_P2 2 MET B 15 ? MET B 23 ? MET B 470 MET B 478 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 4 ? GLY A 5 ? SER A 4 GLY A 5 A 2 GLY A 14 ? ASN A 19 ? GLY A 14 ASN A 19 A 3 GLU A 26 ? SER A 31 ? GLU A 26 SER A 31 A 4 VAL A 37 ? VAL A 41 ? VAL A 37 VAL A 41 B 1 ALA A 7 ? PHE A 9 ? ALA A 7 PHE A 9 B 2 HIS A 87 ? PHE A 91 ? HIS A 87 PHE A 91 B 3 MET A 59 ? ILE A 63 ? MET A 59 ILE A 63 B 4 LYS A 47 ? ALA A 50 ? LYS A 47 ALA A 50 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 5 ? N GLY A 5 O ILE A 16 ? O ILE A 16 A 2 3 N ASN A 19 ? N ASN A 19 O GLU A 26 ? O GLU A 26 A 3 4 N TRP A 29 ? N TRP A 29 O HIS A 38 ? O HIS A 38 B 1 2 N ILE A 8 ? N ILE A 8 O SER A 90 ? O SER A 90 B 2 3 O HIS A 87 ? O HIS A 87 N LEU A 62 ? N LEU A 62 B 3 4 O ARG A 61 ? O ARG A 61 N GLN A 49 ? N GLN A 49 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A ILE 100 ? ? H A LEU 104 ? ? 1.56 2 2 O A MET 58 ? ? H A PHE 91 ? ? 1.59 3 2 O A LEU 104 ? ? H A ILE 108 ? ? 1.59 4 3 O A ILE 100 ? ? H A LEU 104 ? ? 1.57 5 3 O A GLY 5 ? ? H A ILE 16 ? ? 1.59 6 4 O A ILE 100 ? ? H A LEU 104 ? ? 1.58 7 5 O A ILE 100 ? ? H A LEU 104 ? ? 1.60 8 5 O A LEU 104 ? ? H A ILE 108 ? ? 1.60 9 6 O A ILE 100 ? ? H A LEU 104 ? ? 1.55 10 7 O A ILE 100 ? ? H A LEU 104 ? ? 1.59 11 7 O A LEU 104 ? ? H A ILE 108 ? ? 1.59 12 7 O A GLN 49 ? ? H A ARG 61 ? ? 1.60 13 8 O A ILE 100 ? ? H A LEU 104 ? ? 1.58 14 8 H A TRP 29 ? ? O A HIS 38 ? ? 1.59 15 9 H A GLN 49 ? ? O A ARG 61 ? ? 1.55 16 9 O A LEU 104 ? ? H A ILE 108 ? ? 1.58 17 10 O A ILE 100 ? ? H A LEU 104 ? ? 1.55 18 10 O A GLY 5 ? ? H A ILE 16 ? ? 1.57 19 11 O A LEU 104 ? ? H A ILE 108 ? ? 1.59 20 12 O A ILE 100 ? ? H A LEU 104 ? ? 1.56 21 13 O A ILE 100 ? ? H A LEU 104 ? ? 1.56 22 14 O A TRP 29 ? ? H A HIS 38 ? ? 1.60 23 15 H A GLN 49 ? ? O A ARG 61 ? ? 1.60 24 16 H A GLN 49 ? ? O A ARG 61 ? ? 1.56 25 16 O A ILE 100 ? ? H A LEU 104 ? ? 1.56 26 17 O A ILE 100 ? ? H A LEU 104 ? ? 1.56 27 17 O A MET 58 ? ? H A PHE 91 ? ? 1.57 28 18 O A ILE 100 ? ? H A LEU 104 ? ? 1.55 29 18 H A GLN 49 ? ? O A ARG 61 ? ? 1.56 30 18 O A GLY 5 ? ? H A ILE 16 ? ? 1.58 31 18 H A ALA 17 ? ? O A THR 28 ? ? 1.58 32 19 O A ILE 100 ? ? H A LEU 104 ? ? 1.55 33 20 O A ILE 100 ? ? H A LEU 104 ? ? 1.55 34 20 H A ALA 17 ? ? O A THR 28 ? ? 1.59 35 20 O A GLY 5 ? ? H A ILE 16 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 13 ? ? -35.56 126.01 2 1 ASN A 19 ? ? -106.98 66.45 3 1 ALA A 25 ? ? 46.23 105.62 4 1 ASP A 33 ? ? 177.79 44.98 5 1 MET A 58 ? ? 41.38 83.34 6 1 LYS A 65 ? ? 32.99 142.47 7 1 ASP A 67 ? ? -104.57 50.60 8 1 LYS A 71 ? ? -46.13 155.64 9 1 ASP A 74 ? ? -136.23 -46.64 10 1 ASN A 75 ? ? 175.18 -32.88 11 1 GLU A 79 ? ? 38.87 92.85 12 1 PRO A 82 ? ? -50.72 170.70 13 1 ASN A 92 ? ? -141.70 28.25 14 1 PHE B 457 ? ? -168.06 99.15 15 1 SER B 462 ? ? -174.76 112.44 16 1 TYR B 465 ? ? -98.53 31.42 17 1 ASP B 481 ? ? 49.20 75.81 18 1 ILE B 485 ? ? -98.47 31.17 19 1 GLU B 487 ? ? 61.12 179.21 20 1 TYR B 488 ? ? 60.41 79.59 21 2 SER A 13 ? ? -37.13 123.52 22 2 ASN A 19 ? ? -106.14 66.04 23 2 PRO A 24 ? ? -76.29 -103.02 24 2 ALA A 25 ? ? 172.69 141.71 25 2 ASP A 33 ? ? 178.20 45.41 26 2 LYS A 57 ? ? -64.03 -171.07 27 2 MET A 58 ? ? -174.74 98.45 28 2 LYS A 65 ? ? 50.13 -167.85 29 2 ASP A 67 ? ? -50.42 77.90 30 2 SER A 69 ? ? -151.36 24.04 31 2 LYS A 70 ? ? 68.00 97.51 32 2 LYS A 71 ? ? 54.29 178.59 33 2 ASN A 75 ? ? -149.59 -80.65 34 2 PRO A 82 ? ? -59.18 -155.30 35 2 HIS B 460 ? ? -59.89 -74.58 36 2 SER B 462 ? ? -136.41 -59.13 37 2 TYR B 465 ? ? 60.73 -176.24 38 2 LEU B 468 ? ? -177.27 -41.75 39 2 ASP B 481 ? ? 44.71 92.10 40 2 ALA B 482 ? ? -147.22 30.56 41 2 LEU B 483 ? ? -99.84 -70.78 42 2 ILE B 485 ? ? -59.69 99.76 43 3 SER A 23 ? ? -43.80 -70.92 44 3 PRO A 24 ? ? -74.57 -93.98 45 3 ALA A 25 ? ? 177.69 156.88 46 3 ASP A 33 ? ? 178.87 46.62 47 3 LYS A 57 ? ? -55.98 -170.67 48 3 MET A 58 ? ? -171.63 72.10 49 3 LYS A 65 ? ? 38.10 143.91 50 3 VAL A 66 ? ? -130.71 -143.57 51 3 SER A 69 ? ? 178.08 37.02 52 3 LYS A 70 ? ? 60.16 75.99 53 3 LYS A 71 ? ? 65.82 -175.24 54 3 ASN A 75 ? ? -116.09 -79.34 55 3 ASN A 78 ? ? -148.20 -46.61 56 3 GLU A 79 ? ? 44.50 96.17 57 3 ASN A 93 ? ? -174.74 136.54 58 3 THR B 458 ? ? -167.92 -64.05 59 3 TYR B 465 ? ? -167.05 -51.42 60 3 PHE B 479 ? ? -98.76 31.59 61 3 ASP B 486 ? ? -61.76 98.66 62 4 SER A 13 ? ? -38.51 123.29 63 4 PRO A 24 ? ? -75.46 -95.12 64 4 ALA A 25 ? ? 177.85 153.83 65 4 ASP A 33 ? ? -177.91 46.28 66 4 LYS A 57 ? ? -59.49 -166.60 67 4 MET A 58 ? ? -176.58 87.71 68 4 LYS A 65 ? ? 40.40 143.93 69 4 ASP A 67 ? ? -108.35 41.52 70 4 LYS A 70 ? ? -144.57 21.06 71 4 ASP A 74 ? ? -155.94 28.24 72 4 PRO A 82 ? ? -61.23 -166.06 73 4 ASN A 92 ? ? -145.12 26.13 74 4 THR B 458 ? ? 60.63 78.62 75 4 PRO B 459 ? ? -52.34 -176.08 76 4 HIS B 460 ? ? -156.46 31.52 77 4 ASP B 481 ? ? 45.48 87.54 78 4 ALA B 482 ? ? -121.91 -79.32 79 4 LEU B 483 ? ? 55.89 -169.57 80 4 ASP B 486 ? ? -176.49 131.92 81 4 GLU B 487 ? ? -143.01 -61.37 82 5 SER A 13 ? ? -39.19 122.24 83 5 ASN A 19 ? ? -107.59 75.17 84 5 ALA A 25 ? ? 61.12 149.25 85 5 ASP A 33 ? ? 178.11 46.81 86 5 LYS A 57 ? ? -62.09 -164.28 87 5 MET A 58 ? ? -169.21 98.99 88 5 LYS A 65 ? ? 39.59 179.17 89 5 LYS A 71 ? ? 54.54 166.37 90 5 ASP A 74 ? ? -150.93 -73.78 91 5 ASN A 75 ? ? -170.96 33.28 92 5 PRO A 82 ? ? -66.86 -151.20 93 5 ASN A 93 ? ? 176.19 146.26 94 5 PRO B 459 ? ? -51.82 99.92 95 5 HIS B 460 ? ? -132.23 -64.32 96 5 SER B 462 ? ? -142.25 -68.28 97 5 ALA B 467 ? ? -100.24 76.90 98 5 ASP B 469 ? ? -152.33 -49.05 99 5 ASP B 481 ? ? 46.13 82.68 100 5 ILE B 485 ? ? 68.96 -67.58 101 5 ASP B 486 ? ? 59.44 79.72 102 5 GLU B 487 ? ? -70.75 -75.09 103 5 TYR B 488 ? ? -177.08 -64.76 104 6 SER A 13 ? ? -36.34 123.95 105 6 ASN A 19 ? ? -104.39 66.02 106 6 PRO A 24 ? ? -75.95 -104.86 107 6 ALA A 25 ? ? 170.62 136.81 108 6 ASP A 33 ? ? 179.38 45.27 109 6 ASP A 35 ? ? 48.39 27.10 110 6 ALA A 53 ? ? -69.16 70.37 111 6 SER A 54 ? ? 172.35 -30.49 112 6 MET A 58 ? ? 60.77 80.66 113 6 LYS A 65 ? ? 40.67 179.63 114 6 ASP A 67 ? ? -90.10 49.57 115 6 LYS A 71 ? ? -46.34 161.50 116 6 ASP A 74 ? ? -143.79 -74.71 117 6 ASN A 75 ? ? -173.75 34.35 118 6 PRO A 82 ? ? -52.30 -175.32 119 6 ASN A 92 ? ? -140.62 37.18 120 6 ASN A 93 ? ? -176.81 125.44 121 6 SER B 462 ? ? -175.76 -40.82 122 6 PRO B 464 ? ? -69.40 -168.59 123 6 TYR B 465 ? ? -98.08 36.07 124 6 ASP B 481 ? ? 47.06 82.03 125 6 LEU B 483 ? ? -150.01 30.42 126 6 TYR B 488 ? ? -163.54 88.11 127 7 SER A 13 ? ? -37.58 125.54 128 7 ASN A 19 ? ? -106.62 60.32 129 7 ALA A 25 ? ? 48.71 106.56 130 7 ASP A 33 ? ? 178.02 45.88 131 7 LYS A 57 ? ? -66.20 77.14 132 7 MET A 58 ? ? -60.15 96.87 133 7 LYS A 65 ? ? 42.11 143.71 134 7 ASP A 67 ? ? -99.10 42.10 135 7 LYS A 70 ? ? -145.23 21.07 136 7 ASP A 74 ? ? -142.80 46.35 137 7 ASN A 75 ? ? -151.28 -96.56 138 7 PRO A 82 ? ? -55.09 -166.42 139 7 ASN A 93 ? ? 177.87 147.60 140 7 ALA B 463 ? ? 179.91 -55.32 141 7 PRO B 464 ? ? -51.61 -179.04 142 7 TYR B 465 ? ? -168.86 34.02 143 7 ASP B 486 ? ? -154.86 -46.49 144 7 GLU B 487 ? ? -160.52 -51.38 145 7 TYR B 488 ? ? 60.69 169.46 146 8 SER A 13 ? ? -38.92 123.76 147 8 ASN A 19 ? ? -106.29 57.30 148 8 ALA A 25 ? ? 49.18 107.21 149 8 ASP A 33 ? ? 177.18 45.60 150 8 LYS A 57 ? ? -58.94 -166.24 151 8 MET A 58 ? ? -163.79 104.67 152 8 LYS A 65 ? ? 38.19 141.89 153 8 VAL A 66 ? ? -127.34 -140.97 154 8 SER A 69 ? ? 179.29 37.50 155 8 LYS A 70 ? ? 61.28 75.25 156 8 LYS A 71 ? ? 62.07 -168.28 157 8 ASN A 75 ? ? -151.90 -80.19 158 8 GLU A 79 ? ? 38.12 99.01 159 8 PRO A 82 ? ? -86.57 -81.44 160 8 ASN A 93 ? ? -178.59 145.57 161 8 THR B 458 ? ? 60.62 80.34 162 8 HIS B 460 ? ? -174.39 79.37 163 8 ASP B 461 ? ? -129.44 -62.81 164 8 TYR B 465 ? ? -102.64 67.85 165 8 ALA B 467 ? ? -175.82 120.45 166 8 LEU B 468 ? ? -150.25 30.90 167 8 ASP B 481 ? ? 39.12 75.03 168 8 ILE B 485 ? ? -178.23 146.44 169 8 GLU B 487 ? ? -160.49 112.66 170 9 ASN A 19 ? ? -101.66 65.06 171 9 PRO A 24 ? ? -75.65 -103.78 172 9 ALA A 25 ? ? 171.11 137.46 173 9 ASP A 33 ? ? 179.60 46.67 174 9 LYS A 57 ? ? -63.56 85.31 175 9 LYS A 65 ? ? 33.98 141.69 176 9 LYS A 70 ? ? -145.92 29.16 177 9 LYS A 71 ? ? -45.63 157.64 178 9 ASP A 74 ? ? -147.82 32.09 179 9 PRO A 82 ? ? -55.71 -166.47 180 9 ASN A 93 ? ? -173.14 139.46 181 9 THR B 458 ? ? -161.98 89.63 182 9 PRO B 464 ? ? -71.21 -167.62 183 9 LEU B 468 ? ? -169.63 34.62 184 9 ASP B 469 ? ? -153.03 -66.82 185 9 ASP B 481 ? ? 41.28 89.12 186 9 ASP B 486 ? ? -161.27 84.39 187 10 SER A 13 ? ? -34.08 126.00 188 10 PRO A 24 ? ? -73.42 -92.70 189 10 ALA A 25 ? ? 178.28 159.00 190 10 ASP A 33 ? ? 177.42 45.30 191 10 LYS A 57 ? ? -66.12 77.33 192 10 MET A 58 ? ? -58.59 95.20 193 10 LYS A 65 ? ? 58.18 156.69 194 10 ASP A 67 ? ? -51.28 77.33 195 10 SER A 69 ? ? -149.16 23.10 196 10 LYS A 70 ? ? 78.07 -48.11 197 10 ASP A 74 ? ? -144.49 29.30 198 10 ASN A 75 ? ? -69.14 -78.50 199 10 ASN A 78 ? ? -153.45 -45.90 200 10 GLU A 79 ? ? 49.06 145.57 201 10 PRO A 82 ? ? -59.66 -84.82 202 10 ASN A 93 ? ? 178.21 140.26 203 10 PHE B 457 ? ? 60.46 98.88 204 10 ASP B 461 ? ? -70.17 -74.48 205 10 ASP B 481 ? ? 45.25 95.97 206 10 ALA B 482 ? ? -140.22 -73.20 207 10 LEU B 483 ? ? 63.01 -80.15 208 10 ILE B 485 ? ? -178.33 -39.94 209 10 ASP B 486 ? ? -130.70 -50.36 210 10 GLU B 487 ? ? -176.12 145.99 211 11 ALA A 25 ? ? 60.76 149.59 212 11 ASP A 33 ? ? -175.54 47.76 213 11 LYS A 57 ? ? -164.03 100.31 214 11 LYS A 65 ? ? 37.33 -178.84 215 11 LYS A 70 ? ? -145.77 25.14 216 11 ASN A 75 ? ? 80.22 -55.10 217 11 GLU A 79 ? ? -35.68 152.86 218 11 PRO A 82 ? ? -57.06 -164.59 219 11 PHE B 457 ? ? 68.53 -68.03 220 11 THR B 458 ? ? -171.32 -62.84 221 11 PRO B 459 ? ? -65.37 83.73 222 11 HIS B 460 ? ? -168.21 -43.29 223 11 ASP B 461 ? ? -130.73 -59.86 224 11 SER B 462 ? ? 60.32 79.51 225 11 ALA B 463 ? ? -171.30 90.10 226 11 LEU B 468 ? ? -58.60 103.27 227 11 ASP B 481 ? ? 33.73 70.36 228 12 SER A 13 ? ? -37.59 122.88 229 12 ASN A 19 ? ? -99.13 59.05 230 12 GLU A 20 ? ? -89.07 43.14 231 12 VAL A 22 ? ? -54.01 -175.81 232 12 PRO A 24 ? ? -80.70 -105.84 233 12 ALA A 25 ? ? 174.94 138.07 234 12 ASP A 33 ? ? 178.37 43.72 235 12 HIS A 38 ? ? -161.19 115.64 236 12 LYS A 57 ? ? -150.87 -44.28 237 12 MET A 58 ? ? 68.01 70.00 238 12 LYS A 65 ? ? 38.41 143.64 239 12 VAL A 66 ? ? -125.75 -142.62 240 12 SER A 69 ? ? 177.80 37.88 241 12 LYS A 70 ? ? 64.44 68.88 242 12 LYS A 71 ? ? 65.76 -168.91 243 12 ASP A 74 ? ? -160.75 28.04 244 12 GLU A 79 ? ? 48.47 110.62 245 12 ASP B 461 ? ? 60.55 91.68 246 12 TYR B 465 ? ? -120.70 -75.12 247 12 ASP B 469 ? ? -176.41 -166.21 248 12 ASP B 481 ? ? 44.75 75.04 249 12 ILE B 485 ? ? 63.67 113.72 250 12 ASP B 486 ? ? -162.46 85.76 251 12 TYR B 488 ? ? 60.39 104.57 252 13 VAL A 22 ? ? -59.49 170.41 253 13 PRO A 24 ? ? -75.60 -106.59 254 13 ALA A 25 ? ? 171.25 136.53 255 13 LYS A 57 ? ? -62.16 -172.78 256 13 MET A 58 ? ? -170.22 86.16 257 13 LYS A 65 ? ? 36.27 -178.59 258 13 LYS A 70 ? ? -147.11 30.64 259 13 ASP A 74 ? ? 54.25 71.57 260 13 ASN A 75 ? ? -149.20 -79.58 261 13 PRO A 82 ? ? -55.15 -170.60 262 13 HIS B 460 ? ? -169.42 -74.55 263 13 ASP B 461 ? ? -173.57 36.26 264 13 LEU B 468 ? ? 60.48 80.31 265 13 ASP B 481 ? ? 47.17 85.74 266 13 ASP B 486 ? ? -165.54 -49.59 267 13 GLU B 487 ? ? 60.53 79.41 268 14 ASN A 19 ? ? -105.66 62.74 269 14 ALA A 25 ? ? 51.74 127.80 270 14 ASP A 33 ? ? -178.92 45.75 271 14 SER A 55 ? ? -49.41 161.93 272 14 MET A 58 ? ? 61.26 73.82 273 14 LYS A 65 ? ? 34.26 141.32 274 14 LYS A 70 ? ? -144.73 28.77 275 14 ASP A 74 ? ? -137.57 -66.02 276 14 ASN A 75 ? ? -162.20 -95.44 277 14 ASN A 78 ? ? 59.58 179.90 278 14 PRO A 82 ? ? -52.90 -173.62 279 14 ALA B 463 ? ? -167.69 84.93 280 14 LEU B 468 ? ? 60.28 101.78 281 14 LEU B 483 ? ? -99.02 36.31 282 14 GLU B 487 ? ? -146.43 -73.25 283 14 TYR B 488 ? ? -163.02 91.98 284 15 SER A 13 ? ? -34.97 125.34 285 15 ASN A 19 ? ? -103.13 56.60 286 15 ALA A 25 ? ? 59.84 149.28 287 15 ASP A 33 ? ? -177.04 46.29 288 15 MET A 58 ? ? 60.49 73.01 289 15 LYS A 65 ? ? 41.61 -178.13 290 15 ASP A 67 ? ? -109.36 40.36 291 15 LYS A 70 ? ? -144.60 30.06 292 15 ASP A 74 ? ? -150.74 -70.34 293 15 ASN A 75 ? ? 179.65 37.58 294 15 PRO A 82 ? ? -53.64 -171.89 295 15 ASN A 92 ? ? -142.97 42.69 296 15 ASN A 93 ? ? -176.92 137.85 297 15 PRO B 459 ? ? -52.00 90.50 298 15 HIS B 460 ? ? -153.45 87.77 299 15 ASP B 461 ? ? -123.89 -63.48 300 15 ASP B 469 ? ? -59.89 108.64 301 15 ASP B 481 ? ? 44.64 76.71 302 15 ASP B 486 ? ? 60.33 110.57 303 16 SER A 13 ? ? -35.81 125.04 304 16 ASN A 19 ? ? -90.46 57.61 305 16 PRO A 24 ? ? -74.98 -102.99 306 16 ALA A 25 ? ? 172.07 141.44 307 16 ASP A 33 ? ? 177.93 45.10 308 16 ALA A 53 ? ? -69.14 71.56 309 16 SER A 54 ? ? 172.50 -31.86 310 16 LYS A 57 ? ? -66.92 75.31 311 16 MET A 58 ? ? -66.93 95.27 312 16 LYS A 65 ? ? 34.82 141.92 313 16 LYS A 71 ? ? 48.85 177.01 314 16 ASP A 74 ? ? -162.44 46.11 315 16 GLU A 79 ? ? 46.69 78.52 316 16 PRO A 82 ? ? -55.92 -165.27 317 16 ASN A 93 ? ? -179.73 142.37 318 16 HIS B 460 ? ? 55.61 99.88 319 16 ASP B 461 ? ? 68.16 -68.12 320 16 SER B 462 ? ? 63.39 89.57 321 16 ALA B 463 ? ? -174.22 87.25 322 16 PRO B 464 ? ? -51.64 91.77 323 16 TYR B 465 ? ? -145.39 -49.32 324 16 ASP B 481 ? ? 46.07 81.97 325 16 ILE B 485 ? ? -69.96 80.31 326 17 SER A 13 ? ? -37.83 124.58 327 17 ASN A 19 ? ? -111.70 78.24 328 17 ALA A 25 ? ? 60.41 150.00 329 17 ASP A 33 ? ? 178.46 46.86 330 17 LYS A 65 ? ? 41.73 -175.74 331 17 ASP A 67 ? ? -104.68 41.52 332 17 LYS A 70 ? ? -146.50 23.79 333 17 ASP A 74 ? ? 51.92 86.08 334 17 ASN A 75 ? ? -160.60 -80.12 335 17 PRO A 82 ? ? -57.79 -159.22 336 17 ASN A 92 ? ? -141.22 43.93 337 17 ASN A 93 ? ? 177.20 145.88 338 17 ASP B 461 ? ? -105.39 -71.05 339 17 ALA B 467 ? ? -175.69 75.55 340 17 ASP B 481 ? ? 44.75 93.84 341 17 ILE B 485 ? ? 60.09 81.99 342 17 GLU B 487 ? ? 60.28 100.45 343 17 TYR B 488 ? ? 60.58 169.44 344 18 SER A 13 ? ? -37.37 126.59 345 18 PRO A 24 ? ? -84.57 -80.73 346 18 ALA A 25 ? ? 170.73 165.28 347 18 ASP A 33 ? ? -177.64 46.08 348 18 ASP A 46 ? ? -90.55 32.80 349 18 LYS A 57 ? ? -61.72 -164.27 350 18 MET A 58 ? ? -170.62 91.39 351 18 LYS A 65 ? ? 36.59 -179.98 352 18 LYS A 70 ? ? -140.28 34.65 353 18 ASP A 74 ? ? -145.11 33.57 354 18 ASN A 93 ? ? 179.10 141.53 355 18 THR B 458 ? ? -155.05 87.52 356 18 SER B 462 ? ? -150.07 76.75 357 18 ALA B 467 ? ? -164.75 113.93 358 18 ASP B 469 ? ? -68.11 75.14 359 18 ASP B 481 ? ? 45.94 86.11 360 18 ILE B 485 ? ? -141.07 -46.67 361 18 ASP B 486 ? ? -172.06 -42.41 362 18 GLU B 487 ? ? 60.88 156.15 363 18 TYR B 488 ? ? -149.32 -57.19 364 19 GLU A 20 ? ? -97.81 30.22 365 19 PRO A 24 ? ? -73.68 -94.91 366 19 ALA A 25 ? ? 175.84 151.14 367 19 ASP A 33 ? ? -177.36 45.49 368 19 MET A 58 ? ? 33.51 94.37 369 19 LYS A 65 ? ? 35.01 142.09 370 19 LYS A 70 ? ? -144.86 28.44 371 19 PRO A 82 ? ? -56.06 -165.26 372 19 HIS B 460 ? ? 61.58 115.05 373 19 ASP B 461 ? ? -99.06 31.96 374 19 SER B 462 ? ? -124.72 -169.92 375 19 ALA B 467 ? ? -64.58 80.54 376 19 ASP B 481 ? ? 44.29 85.44 377 19 ASP B 486 ? ? -166.12 33.40 378 20 SER A 13 ? ? -38.98 123.56 379 20 GLU A 20 ? ? -98.63 30.00 380 20 PRO A 24 ? ? -75.62 -97.17 381 20 ALA A 25 ? ? 176.66 150.08 382 20 ASP A 33 ? ? -178.83 46.80 383 20 LYS A 57 ? ? -60.27 -166.92 384 20 MET A 58 ? ? -170.65 97.66 385 20 LYS A 65 ? ? 41.12 -178.84 386 20 ASP A 67 ? ? -95.25 41.51 387 20 LYS A 70 ? ? -144.84 25.18 388 20 LYS A 71 ? ? -49.29 164.41 389 20 ASP A 74 ? ? -146.96 -68.25 390 20 ASN A 75 ? ? -174.15 36.25 391 20 PRO A 82 ? ? -55.44 -167.88 392 20 ASN A 93 ? ? -178.17 143.56 393 20 PHE B 457 ? ? -166.44 111.09 394 20 HIS B 460 ? ? 60.21 78.90 395 20 ASP B 461 ? ? 60.29 176.08 396 20 ALA B 463 ? ? -107.37 76.07 397 20 TYR B 465 ? ? 60.53 -175.11 398 20 ALA B 467 ? ? -166.67 116.07 399 20 ILE B 485 ? ? -177.87 -39.66 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K2U _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev 0.395 _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev 0.0025 _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev 29.899 _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev ? _pdbx_nmr_ensemble_rms.distance_rms_dev_error ? _pdbx_nmr_ensemble_rms.entry_id 2K2U _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev 0.281 _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 5 _pdbx_nmr_representative.entry_id 2K2U _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.0 mM [U-99% 15N] Tfb1, 1.0 mM VP16, 90% H2O, 10% D2O' 1 '90% H2O/10% D2O' '1.0 mM [U-99% 13C; U-99% 15N] Tfb1, 1.0 mM VP16, 100% D2O' 2 '100% D2O' '1.0 mM [U-99% 15N] VP16, 1.0 mM Tfb1, 90% H2O, 10% D2O' 3 '90% H2O/10% D2O' '1.0 mM [U-99% 13C; U-99% 15N] VP16, 1.0 mM Tfb1, 100% D2O' 4 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Tfb1 1.0 mM '[U-99% 15N]' 1 VP16 1.0 mM ? 1 Tfb1 1.0 mM '[U-99% 13C; U-99% 15N]' 2 VP16 1.0 mM ? 2 VP16 1.0 mM '[U-99% 15N]' 3 Tfb1 1.0 mM ? 3 VP16 1.0 mM '[U-99% 13C; U-99% 15N]' 4 Tfb1 1.0 mM ? 4 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20mM Sodium Phosphate' _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure Ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 HNCO 1 3 2 HNCACB 1 4 2 '(HB)CBCA(CO)NNH' 1 5 2 'C(CO)NNH' 1 6 1 3D-15N-EDITED-NOESY-HSQC 1 7 2 3D-13C-EDITED-HMQC-NOESY 1 8 2 3D-15N-13C-FILTRED-EDITED-NOESY 1 9 2 '2D 1H-13C HSQC' 1 10 3 '2D 1H-15N HSQC' 1 11 4 '3D HNCO' 1 12 4 '3D HNCACB' 1 13 4 '(HB)CBCA(CO)NNH' 1 14 4 'C(CO)NNH' 1 15 3 3D-15N-EDITED-NOESY-HSQC 1 16 4 3D-15N-13C-EDITED-NOESY-HSQC 1 17 4 3D-15N-13C-FILTRED-EDITED-NOESY 1 18 4 '2D 1H-13C HSQC' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2K2U _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1568 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 578 _pdbx_nmr_constraints.NOE_long_range_total_count 309 _pdbx_nmr_constraints.NOE_medium_range_total_count 194 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 446 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 79 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 79 # _pdbx_nmr_refine.entry_id 2K2U _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ;The three-dimensional structures of the complex Tfb1/VP16 were determined using a set of 1568 NOE-derived distance restraints, 158 backbone dihedral angle (Phi and Psi)restraints and 36 distance restraints from hydrogen bounds., The three-dimensional structures of the complex Tfb1/VP16 were determined using a set of 1568 NOE-derived distance restraints, 158 backbone dihedral angle (Phi and Psi)restraints and 36 distance restraints fron hydrogen bounds. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_software.authors 'Brunger A. T. et.al.' _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CNS _pdbx_nmr_software.version ? _pdbx_nmr_software.ordinal 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Varian UNITY 1 'Varian Unity' 600 Varian UNITY 2 'Varian Unity' # _atom_sites.entry_id 2K2U _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #