data_2K2V # _entry.id 2K2V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K2V pdb_00002k2v 10.2210/pdb2k2v/pdb RCSB RCSB100606 ? ? WWPDB D_1000100606 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-04-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_site 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_conn.pdbx_dist_value' 6 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 14 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 15 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K2V _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-04-13 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 15402 BMRB 'Entry containing chemical shift assignments' unspecified 2p0p PDB 'Entry containing the coordinates of the calcium-free form of this protein' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hu, Y.' 1 'Zhang, X.' 2 'Jin, C.' 3 # _citation.id primary _citation.title 'Anabaena CcbP in the calcium-bound form' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hu, Y.' 1 ? primary 'Zhang, X.' 2 ? primary 'Xia, B.' 3 ? primary 'Jin, C.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Alr1010 protein' 14768.400 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name CcbP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYV EVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF ; _entity_poly.pdbx_seq_one_letter_code_can ;MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYV EVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 VAL n 1 5 GLU n 1 6 ARG n 1 7 ASP n 1 8 GLU n 1 9 THR n 1 10 ARG n 1 11 GLU n 1 12 HIS n 1 13 ARG n 1 14 ILE n 1 15 GLU n 1 16 THR n 1 17 GLU n 1 18 ILE n 1 19 ILE n 1 20 VAL n 1 21 ASP n 1 22 ALA n 1 23 GLU n 1 24 ASP n 1 25 LYS n 1 26 GLU n 1 27 GLU n 1 28 ARG n 1 29 ALA n 1 30 MET n 1 31 GLY n 1 32 TRP n 1 33 TYR n 1 34 TYR n 1 35 TYR n 1 36 LEU n 1 37 ASP n 1 38 ASP n 1 39 THR n 1 40 LEU n 1 41 GLU n 1 42 PHE n 1 43 PRO n 1 44 PHE n 1 45 MET n 1 46 GLY n 1 47 LYS n 1 48 TRP n 1 49 LYS n 1 50 LYS n 1 51 LYS n 1 52 SER n 1 53 ARG n 1 54 LYS n 1 55 THR n 1 56 SER n 1 57 THR n 1 58 ILE n 1 59 GLU n 1 60 GLU n 1 61 LYS n 1 62 THR n 1 63 VAL n 1 64 GLU n 1 65 VAL n 1 66 LEU n 1 67 GLY n 1 68 MET n 1 69 ALA n 1 70 PRO n 1 71 ASP n 1 72 ASP n 1 73 GLU n 1 74 CYS n 1 75 LEU n 1 76 LYS n 1 77 ASP n 1 78 MET n 1 79 TYR n 1 80 VAL n 1 81 GLU n 1 82 VAL n 1 83 ALA n 1 84 ASP n 1 85 ILE n 1 86 GLY n 1 87 GLY n 1 88 LYS n 1 89 ASP n 1 90 ASP n 1 91 ASP n 1 92 VAL n 1 93 TYR n 1 94 THR n 1 95 ALA n 1 96 LYS n 1 97 LEU n 1 98 SER n 1 99 ASP n 1 100 ILE n 1 101 GLU n 1 102 ALA n 1 103 ILE n 1 104 ASP n 1 105 VAL n 1 106 ASP n 1 107 ASP n 1 108 ASP n 1 109 THR n 1 110 GLN n 1 111 GLU n 1 112 ALA n 1 113 ILE n 1 114 ALA n 1 115 ASP n 1 116 TRP n 1 117 LEU n 1 118 TYR n 1 119 TRP n 1 120 LEU n 1 121 ALA n 1 122 ARG n 1 123 GLY n 1 124 TYR n 1 125 LYS n 1 126 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ccbP, alr1010' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'PCC 7120' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Anabaena sp. (strain PCC 7120)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET15b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 TRP 48 48 48 TRP TRP A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 TRP 116 116 116 TRP TRP A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 TRP 119 119 119 TRP TRP A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 PHE 126 126 126 PHE PHE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 127 1 CA CA A . C 2 CA 1 128 2 CA CA A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K2V _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K2V _struct.title 'Anabaena CcbP in the calcium-bound form' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K2V _struct_keywords.pdbx_keywords 'CALCIUM-BINDING PROTEIN' _struct_keywords.text 'calcium-binding, CALCIUM-BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8YY42_ANASP _struct_ref.pdbx_db_accession Q8YY42 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYV EVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K2V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 126 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8YY42 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 126 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 126 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 8 ? THR A 16 ? GLU A 8 THR A 16 1 ? 9 HELX_P HELX_P2 2 ASP A 24 ? LEU A 40 ? ASP A 24 LEU A 40 1 ? 17 HELX_P HELX_P3 3 PRO A 70 ? LEU A 75 ? PRO A 70 LEU A 75 1 ? 6 HELX_P HELX_P4 4 ASP A 106 ? GLY A 123 ? ASP A 106 GLY A 123 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 21 O ? ? ? 1_555 C CA . CA ? ? A ASP 21 A CA 128 1_555 ? ? ? ? ? ? ? 2.914 ? ? metalc2 metalc ? ? A GLU 23 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 23 A CA 128 1_555 ? ? ? ? ? ? ? 2.819 ? ? metalc3 metalc ? ? A ASP 24 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 24 A CA 128 1_555 ? ? ? ? ? ? ? 2.882 ? ? metalc4 metalc ? ? A GLU 27 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 27 A CA 128 1_555 ? ? ? ? ? ? ? 2.736 ? ? metalc5 metalc ? ? A GLU 27 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 27 A CA 128 1_555 ? ? ? ? ? ? ? 2.802 ? ? metalc6 metalc ? ? A ASP 37 O ? ? ? 1_555 B CA . CA ? ? A ASP 37 A CA 127 1_555 ? ? ? ? ? ? ? 2.829 ? ? metalc7 metalc ? ? A ASP 37 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 37 A CA 127 1_555 ? ? ? ? ? ? ? 2.920 ? ? metalc8 metalc ? ? A ASP 38 O ? ? ? 1_555 B CA . CA ? ? A ASP 38 A CA 127 1_555 ? ? ? ? ? ? ? 2.893 ? ? metalc9 metalc ? ? A ASP 38 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 38 A CA 127 1_555 ? ? ? ? ? ? ? 2.911 ? ? metalc10 metalc ? ? A LEU 40 O ? ? ? 1_555 B CA . CA ? ? A LEU 40 A CA 127 1_555 ? ? ? ? ? ? ? 2.873 ? ? metalc11 metalc ? ? A GLU 41 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 41 A CA 127 1_555 ? ? ? ? ? ? ? 2.805 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ASP 21 ? A ASP 21 ? 1_555 CA ? C CA . ? A CA 128 ? 1_555 OE2 ? A GLU 23 ? A GLU 23 ? 1_555 111.7 ? 2 O ? A ASP 21 ? A ASP 21 ? 1_555 CA ? C CA . ? A CA 128 ? 1_555 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 133.6 ? 3 OE2 ? A GLU 23 ? A GLU 23 ? 1_555 CA ? C CA . ? A CA 128 ? 1_555 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 67.2 ? 4 O ? A ASP 21 ? A ASP 21 ? 1_555 CA ? C CA . ? A CA 128 ? 1_555 OE1 ? A GLU 27 ? A GLU 27 ? 1_555 72.5 ? 5 OE2 ? A GLU 23 ? A GLU 23 ? 1_555 CA ? C CA . ? A CA 128 ? 1_555 OE1 ? A GLU 27 ? A GLU 27 ? 1_555 95.8 ? 6 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? C CA . ? A CA 128 ? 1_555 OE1 ? A GLU 27 ? A GLU 27 ? 1_555 61.9 ? 7 O ? A ASP 21 ? A ASP 21 ? 1_555 CA ? C CA . ? A CA 128 ? 1_555 OE2 ? A GLU 27 ? A GLU 27 ? 1_555 82.1 ? 8 OE2 ? A GLU 23 ? A GLU 23 ? 1_555 CA ? C CA . ? A CA 128 ? 1_555 OE2 ? A GLU 27 ? A GLU 27 ? 1_555 135.4 ? 9 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? C CA . ? A CA 128 ? 1_555 OE2 ? A GLU 27 ? A GLU 27 ? 1_555 73.0 ? 10 OE1 ? A GLU 27 ? A GLU 27 ? 1_555 CA ? C CA . ? A CA 128 ? 1_555 OE2 ? A GLU 27 ? A GLU 27 ? 1_555 46.4 ? 11 O ? A ASP 37 ? A ASP 37 ? 1_555 CA ? B CA . ? A CA 127 ? 1_555 OD1 ? A ASP 37 ? A ASP 37 ? 1_555 56.4 ? 12 O ? A ASP 37 ? A ASP 37 ? 1_555 CA ? B CA . ? A CA 127 ? 1_555 O ? A ASP 38 ? A ASP 38 ? 1_555 68.1 ? 13 OD1 ? A ASP 37 ? A ASP 37 ? 1_555 CA ? B CA . ? A CA 127 ? 1_555 O ? A ASP 38 ? A ASP 38 ? 1_555 112.3 ? 14 O ? A ASP 37 ? A ASP 37 ? 1_555 CA ? B CA . ? A CA 127 ? 1_555 OD1 ? A ASP 38 ? A ASP 38 ? 1_555 99.8 ? 15 OD1 ? A ASP 37 ? A ASP 37 ? 1_555 CA ? B CA . ? A CA 127 ? 1_555 OD1 ? A ASP 38 ? A ASP 38 ? 1_555 93.0 ? 16 O ? A ASP 38 ? A ASP 38 ? 1_555 CA ? B CA . ? A CA 127 ? 1_555 OD1 ? A ASP 38 ? A ASP 38 ? 1_555 60.3 ? 17 O ? A ASP 37 ? A ASP 37 ? 1_555 CA ? B CA . ? A CA 127 ? 1_555 O ? A LEU 40 ? A LEU 40 ? 1_555 58.2 ? 18 OD1 ? A ASP 37 ? A ASP 37 ? 1_555 CA ? B CA . ? A CA 127 ? 1_555 O ? A LEU 40 ? A LEU 40 ? 1_555 101.3 ? 19 O ? A ASP 38 ? A ASP 38 ? 1_555 CA ? B CA . ? A CA 127 ? 1_555 O ? A LEU 40 ? A LEU 40 ? 1_555 76.4 ? 20 OD1 ? A ASP 38 ? A ASP 38 ? 1_555 CA ? B CA . ? A CA 127 ? 1_555 O ? A LEU 40 ? A LEU 40 ? 1_555 136.6 ? 21 O ? A ASP 37 ? A ASP 37 ? 1_555 CA ? B CA . ? A CA 127 ? 1_555 OE2 ? A GLU 41 ? A GLU 41 ? 1_555 119.2 ? 22 OD1 ? A ASP 37 ? A ASP 37 ? 1_555 CA ? B CA . ? A CA 127 ? 1_555 OE2 ? A GLU 41 ? A GLU 41 ? 1_555 159.7 ? 23 O ? A ASP 38 ? A ASP 38 ? 1_555 CA ? B CA . ? A CA 127 ? 1_555 OE2 ? A GLU 41 ? A GLU 41 ? 1_555 79.9 ? 24 OD1 ? A ASP 38 ? A ASP 38 ? 1_555 CA ? B CA . ? A CA 127 ? 1_555 OE2 ? A GLU 41 ? A GLU 41 ? 1_555 107.2 ? 25 O ? A LEU 40 ? A LEU 40 ? 1_555 CA ? B CA . ? A CA 127 ? 1_555 OE2 ? A GLU 41 ? A GLU 41 ? 1_555 64.8 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 1 -10.16 2 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 2 -10.30 3 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 3 -10.25 4 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 4 -1.65 5 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 5 -0.75 6 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 6 -2.54 7 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 7 -10.15 8 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 8 1.62 9 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 9 -10.31 10 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 10 -0.46 11 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 11 -1.07 12 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 12 0.66 13 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 13 -0.37 14 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 14 0.42 15 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 15 0.69 16 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 16 -6.49 17 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 17 -0.99 18 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 18 0.07 19 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 19 -2.36 20 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 20 -10.16 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 93 ? LYS A 96 ? TYR A 93 LYS A 96 A 2 TYR A 79 ? ASP A 84 ? TYR A 79 ASP A 84 A 3 ILE A 58 ? MET A 68 ? ILE A 58 MET A 68 A 4 PHE A 44 ? LYS A 51 ? PHE A 44 LYS A 51 A 5 ILE A 100 ? ILE A 103 ? ILE A 100 ILE A 103 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 93 ? O TYR A 93 N VAL A 82 ? N VAL A 82 A 2 3 O ALA A 83 ? O ALA A 83 N GLU A 64 ? N GLU A 64 A 3 4 O VAL A 65 ? O VAL A 65 N PHE A 44 ? N PHE A 44 A 4 5 N MET A 45 ? N MET A 45 O ILE A 103 ? O ILE A 103 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 127 ? 2 'BINDING SITE FOR RESIDUE CA A 127' AC2 Software A CA 128 ? 3 'BINDING SITE FOR RESIDUE CA A 128' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ASP A 37 ? ASP A 37 . ? 1_555 ? 2 AC1 2 ASP A 38 ? ASP A 38 . ? 1_555 ? 3 AC2 3 ASP A 21 ? ASP A 21 . ? 1_555 ? 4 AC2 3 GLU A 23 ? GLU A 23 . ? 1_555 ? 5 AC2 3 ASP A 24 ? ASP A 24 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 OD1 A ASP 106 ? ? HG1 A THR 109 ? ? 1.60 2 3 OD1 A ASP 106 ? ? HG1 A THR 109 ? ? 1.60 3 4 OD1 A ASP 106 ? ? HG1 A THR 109 ? ? 1.60 4 8 OD2 A ASP 7 ? ? HG1 A THR 9 ? ? 1.59 5 9 OD1 A ASP 77 ? ? HH A TYR 124 ? ? 1.60 6 12 OD1 A ASP 77 ? ? HH A TYR 124 ? ? 1.60 7 16 OD2 A ASP 7 ? ? HG1 A THR 9 ? ? 1.59 8 20 OD1 A ASP 106 ? ? HG1 A THR 109 ? ? 1.60 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 4 CB A ASP 37 ? ? CG A ASP 37 ? ? OD1 A ASP 37 ? ? 124.21 118.30 5.91 0.90 N 2 5 CB A ASP 37 ? ? CG A ASP 37 ? ? OD1 A ASP 37 ? ? 124.36 118.30 6.06 0.90 N 3 6 CB A ASP 37 ? ? CG A ASP 37 ? ? OD1 A ASP 37 ? ? 124.43 118.30 6.13 0.90 N 4 8 CB A ASP 37 ? ? CG A ASP 37 ? ? OD1 A ASP 37 ? ? 124.08 118.30 5.78 0.90 N 5 10 CB A ASP 37 ? ? CG A ASP 37 ? ? OD1 A ASP 37 ? ? 124.24 118.30 5.94 0.90 N 6 11 CB A ASP 37 ? ? CG A ASP 37 ? ? OD1 A ASP 37 ? ? 124.05 118.30 5.75 0.90 N 7 12 CB A ASP 37 ? ? CG A ASP 37 ? ? OD1 A ASP 37 ? ? 123.86 118.30 5.56 0.90 N 8 13 CB A ASP 37 ? ? CG A ASP 37 ? ? OD1 A ASP 37 ? ? 124.00 118.30 5.70 0.90 N 9 14 CB A ASP 37 ? ? CG A ASP 37 ? ? OD1 A ASP 37 ? ? 124.37 118.30 6.07 0.90 N 10 15 CB A ASP 37 ? ? CG A ASP 37 ? ? OD1 A ASP 37 ? ? 123.90 118.30 5.60 0.90 N 11 16 NE A ARG 13 ? ? CZ A ARG 13 ? ? NH1 A ARG 13 ? ? 123.31 120.30 3.01 0.50 N 12 16 CB A ASP 37 ? ? CG A ASP 37 ? ? OD1 A ASP 37 ? ? 124.17 118.30 5.87 0.90 N 13 17 CB A ASP 37 ? ? CG A ASP 37 ? ? OD1 A ASP 37 ? ? 123.95 118.30 5.65 0.90 N 14 18 CB A ASP 37 ? ? CG A ASP 37 ? ? OD1 A ASP 37 ? ? 123.97 118.30 5.67 0.90 N 15 19 CB A ASP 37 ? ? CG A ASP 37 ? ? OD1 A ASP 37 ? ? 124.40 118.30 6.10 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 17 ? ? -146.82 -54.57 2 1 GLU A 23 ? ? -156.25 -19.65 3 1 SER A 56 ? ? -64.92 10.90 4 1 ASP A 89 ? ? 49.85 21.03 5 1 ASP A 90 ? ? -155.33 12.31 6 1 TYR A 124 ? ? 59.40 170.84 7 2 GLU A 23 ? ? -144.91 -31.50 8 2 THR A 55 ? ? 53.85 -98.85 9 2 SER A 56 ? ? -146.02 30.52 10 2 ASP A 89 ? ? -142.03 10.67 11 2 ASP A 90 ? ? -150.41 24.33 12 2 TYR A 124 ? ? 41.80 -152.98 13 2 LYS A 125 ? ? -128.78 -57.59 14 3 SER A 3 ? ? -140.56 25.82 15 3 GLU A 17 ? ? -140.96 -53.35 16 3 GLU A 23 ? ? -143.08 -28.88 17 3 LYS A 54 ? ? 45.65 -132.79 18 3 SER A 56 ? ? -162.96 15.33 19 3 CYS A 74 ? ? -78.82 44.23 20 3 LYS A 88 ? ? -83.24 35.02 21 3 LYS A 125 ? ? -142.00 10.13 22 4 VAL A 4 ? ? -145.28 21.98 23 4 GLU A 23 ? ? -160.18 -20.81 24 4 ASP A 89 ? ? 48.62 25.66 25 4 ASP A 90 ? ? -153.62 12.38 26 4 TYR A 124 ? ? -57.94 170.65 27 5 GLU A 23 ? ? -154.06 -20.02 28 5 LYS A 88 ? ? -83.79 36.22 29 5 SER A 98 ? ? -66.41 1.16 30 6 SER A 3 ? ? -74.69 29.79 31 6 GLU A 5 ? ? 29.29 -103.99 32 6 ASP A 7 ? ? 37.68 -120.29 33 6 GLU A 23 ? ? -159.08 -27.64 34 6 CYS A 74 ? ? -69.38 0.22 35 6 LYS A 88 ? ? -83.03 36.53 36 7 ASP A 7 ? ? 141.40 48.64 37 7 GLU A 8 ? ? 59.94 4.48 38 7 GLU A 23 ? ? -160.61 -32.81 39 7 GLU A 41 ? ? -119.00 67.40 40 7 SER A 52 ? ? 51.53 -162.27 41 7 LYS A 88 ? ? 61.12 -62.21 42 7 ASP A 90 ? ? -152.99 13.37 43 7 TYR A 124 ? ? 57.57 169.15 44 8 GLU A 23 ? ? -153.64 -18.86 45 8 THR A 55 ? ? 66.37 162.02 46 8 LYS A 88 ? ? -145.42 -34.38 47 8 TYR A 124 ? ? 59.09 168.98 48 9 SER A 3 ? ? -144.27 34.42 49 9 ASP A 7 ? ? -156.57 44.95 50 9 GLU A 8 ? ? 56.70 16.63 51 9 GLU A 23 ? ? -153.45 -20.12 52 9 THR A 55 ? ? 68.69 143.93 53 9 LYS A 88 ? ? -132.92 -67.28 54 9 ASP A 89 ? ? 49.85 22.37 55 9 ASP A 90 ? ? -152.35 10.72 56 9 TYR A 124 ? ? 61.19 170.75 57 10 GLU A 5 ? ? -67.50 81.27 58 10 ILE A 18 ? ? -120.18 -50.06 59 10 GLU A 23 ? ? -159.33 -26.87 60 10 SER A 56 ? ? -64.84 5.87 61 10 LYS A 88 ? ? -84.39 41.63 62 11 SER A 3 ? ? -140.01 22.35 63 11 GLU A 23 ? ? -147.57 -24.80 64 11 ARG A 53 ? ? -155.78 -50.19 65 11 THR A 55 ? ? 64.52 -157.69 66 11 SER A 56 ? ? -65.80 18.56 67 11 ASP A 89 ? ? 57.73 -20.10 68 11 ASP A 90 ? ? -141.44 22.79 69 11 TYR A 124 ? ? 55.13 176.47 70 11 LYS A 125 ? ? -141.14 -38.78 71 12 GLU A 5 ? ? 39.84 -82.50 72 12 ARG A 6 ? ? -68.63 11.95 73 12 GLU A 17 ? ? -148.77 -49.48 74 12 GLU A 23 ? ? -151.86 -22.24 75 12 ARG A 53 ? ? 67.11 161.46 76 12 ASP A 89 ? ? 178.94 174.15 77 12 TYR A 124 ? ? 57.15 171.05 78 13 GLU A 8 ? ? -59.79 -8.72 79 13 GLU A 23 ? ? -142.92 -32.72 80 13 LYS A 51 ? ? -87.88 48.02 81 13 SER A 52 ? ? -143.23 24.65 82 13 LYS A 54 ? ? -158.53 -64.57 83 13 SER A 56 ? ? -69.42 64.34 84 13 ASP A 89 ? ? 62.44 115.51 85 13 ASP A 90 ? ? 68.06 -8.43 86 13 TYR A 124 ? ? 60.58 177.68 87 14 GLU A 5 ? ? -77.47 40.75 88 14 GLU A 23 ? ? -153.83 -23.17 89 14 CYS A 74 ? ? -69.31 1.93 90 14 ASP A 89 ? ? 49.94 21.80 91 14 ASP A 90 ? ? -154.82 12.43 92 15 SER A 3 ? ? -78.78 28.76 93 15 GLU A 23 ? ? -148.71 -30.69 94 15 SER A 52 ? ? -147.33 19.94 95 15 LYS A 54 ? ? -140.13 -49.00 96 15 THR A 55 ? ? -138.60 -66.86 97 15 ASP A 89 ? ? 48.52 20.95 98 15 ASP A 90 ? ? -157.78 12.07 99 15 TYR A 124 ? ? 59.08 161.52 100 15 LYS A 125 ? ? -140.61 15.74 101 16 GLU A 23 ? ? -154.90 -18.39 102 16 LYS A 54 ? ? -145.13 12.71 103 16 CYS A 74 ? ? -92.34 32.39 104 16 LYS A 88 ? ? 68.87 -15.51 105 16 TYR A 124 ? ? 51.57 161.74 106 17 GLU A 23 ? ? -152.79 -25.02 107 17 LYS A 49 ? ? -105.19 65.88 108 17 ARG A 53 ? ? 63.99 166.19 109 17 CYS A 74 ? ? -69.63 12.24 110 17 ASP A 89 ? ? 48.14 18.97 111 17 ASP A 90 ? ? -156.99 11.75 112 18 ASP A 7 ? ? 176.99 164.49 113 18 GLU A 23 ? ? -175.90 -31.83 114 18 CYS A 74 ? ? -76.67 24.32 115 18 LYS A 76 ? ? -132.51 -37.11 116 18 LYS A 88 ? ? -146.45 -36.13 117 18 ASP A 90 ? ? -151.04 13.40 118 19 GLU A 23 ? ? -149.57 -31.25 119 20 VAL A 4 ? ? -154.86 49.46 120 20 GLU A 17 ? ? -150.20 -61.13 121 20 GLU A 23 ? ? -153.49 -20.97 122 20 LYS A 49 ? ? -103.47 65.50 123 20 ARG A 53 ? ? -148.72 -43.76 124 20 LYS A 54 ? ? -141.10 -62.27 125 20 SER A 56 ? ? -78.50 34.45 126 20 LYS A 76 ? ? -130.85 -32.89 127 20 LYS A 88 ? ? -84.27 34.87 128 20 TYR A 124 ? ? 60.59 168.34 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 122 ? ? 0.078 'SIDE CHAIN' 2 8 ARG A 6 ? ? 0.161 'SIDE CHAIN' 3 9 TYR A 93 ? ? 0.068 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K2V _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K2V _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-100% 13C; U-100% 15N] protein, 40 mM CALCIUM ION, 20 mM TRIS, 220 mM sodium chloride, 10 mM DTT, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 15N] protein, 40 mM CALCIUM ION, 20 mM TRIS, 220 mM sodium chloride, 10 mM DTT, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein 1 mM '[U-100% 13C; U-100% 15N]' 1 'CALCIUM ION' 40 mM ? 1 TRIS 20 mM ? 1 'sodium chloride' 220 mM ? 1 DTT 10 mM ? 1 protein 1 mM '[U-100% 15N]' 2 'CALCIUM ION' 40 mM ? 2 TRIS 20 mM ? 2 'sodium chloride' 220 mM ? 2 DTT 10 mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.32 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-13C NOESY' 1 2 2 '3D 1H-15N NOESY' 1 3 1 '3D HCCH-COSY' 1 4 1 '3D HCCH-TOCSY' 1 5 1 '3D HNCO' 1 6 1 '3D HNCACB' 1 7 1 '3D CBCA(CO)NH' 1 8 1 '2D 1H-13C HSQC' 1 9 2 '2D 1H-15N HSQC' # _pdbx_nmr_refine.entry_id 2K2V _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection XwinNMR 3.5 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2.1 2 'Johnson, One Moon Scientific' 'data analysis' NMRView 5 3 'Johnson, One Moon Scientific' 'peak picking' NMRView 5 4 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView 5 5 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 6 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.0 7 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, Kollm' refinement Amber 7.0 8 'Duggan, Legge, Dyson, Wright' 'data analysis' SANE ? 9 'Koradi, Billeter and Wuthrich' 'data analysis' MOLMOL 2K.2 10 'Laskowski and MacArthur' 'data analysis' ProcheckNMR ? 11 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CA CA CA N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 HIS N N N N 121 HIS CA C N S 122 HIS C C N N 123 HIS O O N N 124 HIS CB C N N 125 HIS CG C Y N 126 HIS ND1 N Y N 127 HIS CD2 C Y N 128 HIS CE1 C Y N 129 HIS NE2 N Y N 130 HIS OXT O N N 131 HIS H H N N 132 HIS H2 H N N 133 HIS HA H N N 134 HIS HB2 H N N 135 HIS HB3 H N N 136 HIS HD1 H N N 137 HIS HD2 H N N 138 HIS HE1 H N N 139 HIS HE2 H N N 140 HIS HXT H N N 141 ILE N N N N 142 ILE CA C N S 143 ILE C C N N 144 ILE O O N N 145 ILE CB C N S 146 ILE CG1 C N N 147 ILE CG2 C N N 148 ILE CD1 C N N 149 ILE OXT O N N 150 ILE H H N N 151 ILE H2 H N N 152 ILE HA H N N 153 ILE HB H N N 154 ILE HG12 H N N 155 ILE HG13 H N N 156 ILE HG21 H N N 157 ILE HG22 H N N 158 ILE HG23 H N N 159 ILE HD11 H N N 160 ILE HD12 H N N 161 ILE HD13 H N N 162 ILE HXT H N N 163 LEU N N N N 164 LEU CA C N S 165 LEU C C N N 166 LEU O O N N 167 LEU CB C N N 168 LEU CG C N N 169 LEU CD1 C N N 170 LEU CD2 C N N 171 LEU OXT O N N 172 LEU H H N N 173 LEU H2 H N N 174 LEU HA H N N 175 LEU HB2 H N N 176 LEU HB3 H N N 177 LEU HG H N N 178 LEU HD11 H N N 179 LEU HD12 H N N 180 LEU HD13 H N N 181 LEU HD21 H N N 182 LEU HD22 H N N 183 LEU HD23 H N N 184 LEU HXT H N N 185 LYS N N N N 186 LYS CA C N S 187 LYS C C N N 188 LYS O O N N 189 LYS CB C N N 190 LYS CG C N N 191 LYS CD C N N 192 LYS CE C N N 193 LYS NZ N N N 194 LYS OXT O N N 195 LYS H H N N 196 LYS H2 H N N 197 LYS HA H N N 198 LYS HB2 H N N 199 LYS HB3 H N N 200 LYS HG2 H N N 201 LYS HG3 H N N 202 LYS HD2 H N N 203 LYS HD3 H N N 204 LYS HE2 H N N 205 LYS HE3 H N N 206 LYS HZ1 H N N 207 LYS HZ2 H N N 208 LYS HZ3 H N N 209 LYS HXT H N N 210 MET N N N N 211 MET CA C N S 212 MET C C N N 213 MET O O N N 214 MET CB C N N 215 MET CG C N N 216 MET SD S N N 217 MET CE C N N 218 MET OXT O N N 219 MET H H N N 220 MET H2 H N N 221 MET HA H N N 222 MET HB2 H N N 223 MET HB3 H N N 224 MET HG2 H N N 225 MET HG3 H N N 226 MET HE1 H N N 227 MET HE2 H N N 228 MET HE3 H N N 229 MET HXT H N N 230 PHE N N N N 231 PHE CA C N S 232 PHE C C N N 233 PHE O O N N 234 PHE CB C N N 235 PHE CG C Y N 236 PHE CD1 C Y N 237 PHE CD2 C Y N 238 PHE CE1 C Y N 239 PHE CE2 C Y N 240 PHE CZ C Y N 241 PHE OXT O N N 242 PHE H H N N 243 PHE H2 H N N 244 PHE HA H N N 245 PHE HB2 H N N 246 PHE HB3 H N N 247 PHE HD1 H N N 248 PHE HD2 H N N 249 PHE HE1 H N N 250 PHE HE2 H N N 251 PHE HZ H N N 252 PHE HXT H N N 253 PRO N N N N 254 PRO CA C N S 255 PRO C C N N 256 PRO O O N N 257 PRO CB C N N 258 PRO CG C N N 259 PRO CD C N N 260 PRO OXT O N N 261 PRO H H N N 262 PRO HA H N N 263 PRO HB2 H N N 264 PRO HB3 H N N 265 PRO HG2 H N N 266 PRO HG3 H N N 267 PRO HD2 H N N 268 PRO HD3 H N N 269 PRO HXT H N N 270 SER N N N N 271 SER CA C N S 272 SER C C N N 273 SER O O N N 274 SER CB C N N 275 SER OG O N N 276 SER OXT O N N 277 SER H H N N 278 SER H2 H N N 279 SER HA H N N 280 SER HB2 H N N 281 SER HB3 H N N 282 SER HG H N N 283 SER HXT H N N 284 THR N N N N 285 THR CA C N S 286 THR C C N N 287 THR O O N N 288 THR CB C N R 289 THR OG1 O N N 290 THR CG2 C N N 291 THR OXT O N N 292 THR H H N N 293 THR H2 H N N 294 THR HA H N N 295 THR HB H N N 296 THR HG1 H N N 297 THR HG21 H N N 298 THR HG22 H N N 299 THR HG23 H N N 300 THR HXT H N N 301 TRP N N N N 302 TRP CA C N S 303 TRP C C N N 304 TRP O O N N 305 TRP CB C N N 306 TRP CG C Y N 307 TRP CD1 C Y N 308 TRP CD2 C Y N 309 TRP NE1 N Y N 310 TRP CE2 C Y N 311 TRP CE3 C Y N 312 TRP CZ2 C Y N 313 TRP CZ3 C Y N 314 TRP CH2 C Y N 315 TRP OXT O N N 316 TRP H H N N 317 TRP H2 H N N 318 TRP HA H N N 319 TRP HB2 H N N 320 TRP HB3 H N N 321 TRP HD1 H N N 322 TRP HE1 H N N 323 TRP HE3 H N N 324 TRP HZ2 H N N 325 TRP HZ3 H N N 326 TRP HH2 H N N 327 TRP HXT H N N 328 TYR N N N N 329 TYR CA C N S 330 TYR C C N N 331 TYR O O N N 332 TYR CB C N N 333 TYR CG C Y N 334 TYR CD1 C Y N 335 TYR CD2 C Y N 336 TYR CE1 C Y N 337 TYR CE2 C Y N 338 TYR CZ C Y N 339 TYR OH O N N 340 TYR OXT O N N 341 TYR H H N N 342 TYR H2 H N N 343 TYR HA H N N 344 TYR HB2 H N N 345 TYR HB3 H N N 346 TYR HD1 H N N 347 TYR HD2 H N N 348 TYR HE1 H N N 349 TYR HE2 H N N 350 TYR HH H N N 351 TYR HXT H N N 352 VAL N N N N 353 VAL CA C N S 354 VAL C C N N 355 VAL O O N N 356 VAL CB C N N 357 VAL CG1 C N N 358 VAL CG2 C N N 359 VAL OXT O N N 360 VAL H H N N 361 VAL H2 H N N 362 VAL HA H N N 363 VAL HB H N N 364 VAL HG11 H N N 365 VAL HG12 H N N 366 VAL HG13 H N N 367 VAL HG21 H N N 368 VAL HG22 H N N 369 VAL HG23 H N N 370 VAL HXT H N N 371 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 ILE N CA sing N N 134 ILE N H sing N N 135 ILE N H2 sing N N 136 ILE CA C sing N N 137 ILE CA CB sing N N 138 ILE CA HA sing N N 139 ILE C O doub N N 140 ILE C OXT sing N N 141 ILE CB CG1 sing N N 142 ILE CB CG2 sing N N 143 ILE CB HB sing N N 144 ILE CG1 CD1 sing N N 145 ILE CG1 HG12 sing N N 146 ILE CG1 HG13 sing N N 147 ILE CG2 HG21 sing N N 148 ILE CG2 HG22 sing N N 149 ILE CG2 HG23 sing N N 150 ILE CD1 HD11 sing N N 151 ILE CD1 HD12 sing N N 152 ILE CD1 HD13 sing N N 153 ILE OXT HXT sing N N 154 LEU N CA sing N N 155 LEU N H sing N N 156 LEU N H2 sing N N 157 LEU CA C sing N N 158 LEU CA CB sing N N 159 LEU CA HA sing N N 160 LEU C O doub N N 161 LEU C OXT sing N N 162 LEU CB CG sing N N 163 LEU CB HB2 sing N N 164 LEU CB HB3 sing N N 165 LEU CG CD1 sing N N 166 LEU CG CD2 sing N N 167 LEU CG HG sing N N 168 LEU CD1 HD11 sing N N 169 LEU CD1 HD12 sing N N 170 LEU CD1 HD13 sing N N 171 LEU CD2 HD21 sing N N 172 LEU CD2 HD22 sing N N 173 LEU CD2 HD23 sing N N 174 LEU OXT HXT sing N N 175 LYS N CA sing N N 176 LYS N H sing N N 177 LYS N H2 sing N N 178 LYS CA C sing N N 179 LYS CA CB sing N N 180 LYS CA HA sing N N 181 LYS C O doub N N 182 LYS C OXT sing N N 183 LYS CB CG sing N N 184 LYS CB HB2 sing N N 185 LYS CB HB3 sing N N 186 LYS CG CD sing N N 187 LYS CG HG2 sing N N 188 LYS CG HG3 sing N N 189 LYS CD CE sing N N 190 LYS CD HD2 sing N N 191 LYS CD HD3 sing N N 192 LYS CE NZ sing N N 193 LYS CE HE2 sing N N 194 LYS CE HE3 sing N N 195 LYS NZ HZ1 sing N N 196 LYS NZ HZ2 sing N N 197 LYS NZ HZ3 sing N N 198 LYS OXT HXT sing N N 199 MET N CA sing N N 200 MET N H sing N N 201 MET N H2 sing N N 202 MET CA C sing N N 203 MET CA CB sing N N 204 MET CA HA sing N N 205 MET C O doub N N 206 MET C OXT sing N N 207 MET CB CG sing N N 208 MET CB HB2 sing N N 209 MET CB HB3 sing N N 210 MET CG SD sing N N 211 MET CG HG2 sing N N 212 MET CG HG3 sing N N 213 MET SD CE sing N N 214 MET CE HE1 sing N N 215 MET CE HE2 sing N N 216 MET CE HE3 sing N N 217 MET OXT HXT sing N N 218 PHE N CA sing N N 219 PHE N H sing N N 220 PHE N H2 sing N N 221 PHE CA C sing N N 222 PHE CA CB sing N N 223 PHE CA HA sing N N 224 PHE C O doub N N 225 PHE C OXT sing N N 226 PHE CB CG sing N N 227 PHE CB HB2 sing N N 228 PHE CB HB3 sing N N 229 PHE CG CD1 doub Y N 230 PHE CG CD2 sing Y N 231 PHE CD1 CE1 sing Y N 232 PHE CD1 HD1 sing N N 233 PHE CD2 CE2 doub Y N 234 PHE CD2 HD2 sing N N 235 PHE CE1 CZ doub Y N 236 PHE CE1 HE1 sing N N 237 PHE CE2 CZ sing Y N 238 PHE CE2 HE2 sing N N 239 PHE CZ HZ sing N N 240 PHE OXT HXT sing N N 241 PRO N CA sing N N 242 PRO N CD sing N N 243 PRO N H sing N N 244 PRO CA C sing N N 245 PRO CA CB sing N N 246 PRO CA HA sing N N 247 PRO C O doub N N 248 PRO C OXT sing N N 249 PRO CB CG sing N N 250 PRO CB HB2 sing N N 251 PRO CB HB3 sing N N 252 PRO CG CD sing N N 253 PRO CG HG2 sing N N 254 PRO CG HG3 sing N N 255 PRO CD HD2 sing N N 256 PRO CD HD3 sing N N 257 PRO OXT HXT sing N N 258 SER N CA sing N N 259 SER N H sing N N 260 SER N H2 sing N N 261 SER CA C sing N N 262 SER CA CB sing N N 263 SER CA HA sing N N 264 SER C O doub N N 265 SER C OXT sing N N 266 SER CB OG sing N N 267 SER CB HB2 sing N N 268 SER CB HB3 sing N N 269 SER OG HG sing N N 270 SER OXT HXT sing N N 271 THR N CA sing N N 272 THR N H sing N N 273 THR N H2 sing N N 274 THR CA C sing N N 275 THR CA CB sing N N 276 THR CA HA sing N N 277 THR C O doub N N 278 THR C OXT sing N N 279 THR CB OG1 sing N N 280 THR CB CG2 sing N N 281 THR CB HB sing N N 282 THR OG1 HG1 sing N N 283 THR CG2 HG21 sing N N 284 THR CG2 HG22 sing N N 285 THR CG2 HG23 sing N N 286 THR OXT HXT sing N N 287 TRP N CA sing N N 288 TRP N H sing N N 289 TRP N H2 sing N N 290 TRP CA C sing N N 291 TRP CA CB sing N N 292 TRP CA HA sing N N 293 TRP C O doub N N 294 TRP C OXT sing N N 295 TRP CB CG sing N N 296 TRP CB HB2 sing N N 297 TRP CB HB3 sing N N 298 TRP CG CD1 doub Y N 299 TRP CG CD2 sing Y N 300 TRP CD1 NE1 sing Y N 301 TRP CD1 HD1 sing N N 302 TRP CD2 CE2 doub Y N 303 TRP CD2 CE3 sing Y N 304 TRP NE1 CE2 sing Y N 305 TRP NE1 HE1 sing N N 306 TRP CE2 CZ2 sing Y N 307 TRP CE3 CZ3 doub Y N 308 TRP CE3 HE3 sing N N 309 TRP CZ2 CH2 doub Y N 310 TRP CZ2 HZ2 sing N N 311 TRP CZ3 CH2 sing Y N 312 TRP CZ3 HZ3 sing N N 313 TRP CH2 HH2 sing N N 314 TRP OXT HXT sing N N 315 TYR N CA sing N N 316 TYR N H sing N N 317 TYR N H2 sing N N 318 TYR CA C sing N N 319 TYR CA CB sing N N 320 TYR CA HA sing N N 321 TYR C O doub N N 322 TYR C OXT sing N N 323 TYR CB CG sing N N 324 TYR CB HB2 sing N N 325 TYR CB HB3 sing N N 326 TYR CG CD1 doub Y N 327 TYR CG CD2 sing Y N 328 TYR CD1 CE1 sing Y N 329 TYR CD1 HD1 sing N N 330 TYR CD2 CE2 doub Y N 331 TYR CD2 HD2 sing N N 332 TYR CE1 CZ doub Y N 333 TYR CE1 HE1 sing N N 334 TYR CE2 CZ sing Y N 335 TYR CE2 HE2 sing N N 336 TYR CZ OH sing N N 337 TYR OH HH sing N N 338 TYR OXT HXT sing N N 339 VAL N CA sing N N 340 VAL N H sing N N 341 VAL N H2 sing N N 342 VAL CA C sing N N 343 VAL CA CB sing N N 344 VAL CA HA sing N N 345 VAL C O doub N N 346 VAL C OXT sing N N 347 VAL CB CG1 sing N N 348 VAL CB CG2 sing N N 349 VAL CB HB sing N N 350 VAL CG1 HG11 sing N N 351 VAL CG1 HG12 sing N N 352 VAL CG1 HG13 sing N N 353 VAL CG2 HG21 sing N N 354 VAL CG2 HG22 sing N N 355 VAL CG2 HG23 sing N N 356 VAL OXT HXT sing N N 357 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2K2V _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_