data_2K2W # _entry.id 2K2W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K2W pdb_00002k2w 10.2210/pdb2k2w/pdb RCSB RCSB100607 ? ? WWPDB D_1000100607 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-06-17 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K2W _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-04-14 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xu, C.' 1 'Cui, G.' 2 'Botuyan, M.' 3 'Mer, G.' 4 # _citation.id primary _citation.title ;Structure of a second BRCT domain identified in the nijmegen breakage syndrome protein Nbs1 and its function in an MDC1-dependent localization of Nbs1 to DNA damage sites. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 381 _citation.page_first 361 _citation.page_last 372 _citation.year 2008 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18582474 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2008.05.087 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, C.' 1 ? primary 'Wu, L.' 2 ? primary 'Cui, G.' 3 ? primary 'Botuyan, M.V.' 4 ? primary 'Chen, J.' 5 ? primary 'Mer, G.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Recombination and DNA repair protein' _entity.formula_weight 13237.317 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHMKRKSIFKDKVFLFLNAKQYKKLSPAVLFGGGKTDLLMGELKDASVLDNPATCVIDVAMTESQLSESQSTQPW ITSTLDLLQSKGLRTIPEAEIGLAVINVSTEIYCNPRR ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHMKRKSIFKDKVFLFLNAKQYKKLSPAVLFGGGKTDLLMGELKDASVLDNPATCVIDVAMTESQLSESQSTQPW ITSTLDLLQSKGLRTIPEAEIGLAVINVSTEIYCNPRR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 MET n 1 9 LYS n 1 10 ARG n 1 11 LYS n 1 12 SER n 1 13 ILE n 1 14 PHE n 1 15 LYS n 1 16 ASP n 1 17 LYS n 1 18 VAL n 1 19 PHE n 1 20 LEU n 1 21 PHE n 1 22 LEU n 1 23 ASN n 1 24 ALA n 1 25 LYS n 1 26 GLN n 1 27 TYR n 1 28 LYS n 1 29 LYS n 1 30 LEU n 1 31 SER n 1 32 PRO n 1 33 ALA n 1 34 VAL n 1 35 LEU n 1 36 PHE n 1 37 GLY n 1 38 GLY n 1 39 GLY n 1 40 LYS n 1 41 THR n 1 42 ASP n 1 43 LEU n 1 44 LEU n 1 45 MET n 1 46 GLY n 1 47 GLU n 1 48 LEU n 1 49 LYS n 1 50 ASP n 1 51 ALA n 1 52 SER n 1 53 VAL n 1 54 LEU n 1 55 ASP n 1 56 ASN n 1 57 PRO n 1 58 ALA n 1 59 THR n 1 60 CYS n 1 61 VAL n 1 62 ILE n 1 63 ASP n 1 64 VAL n 1 65 ALA n 1 66 MET n 1 67 THR n 1 68 GLU n 1 69 SER n 1 70 GLN n 1 71 LEU n 1 72 SER n 1 73 GLU n 1 74 SER n 1 75 GLN n 1 76 SER n 1 77 THR n 1 78 GLN n 1 79 PRO n 1 80 TRP n 1 81 ILE n 1 82 THR n 1 83 SER n 1 84 THR n 1 85 LEU n 1 86 ASP n 1 87 LEU n 1 88 LEU n 1 89 GLN n 1 90 SER n 1 91 LYS n 1 92 GLY n 1 93 LEU n 1 94 ARG n 1 95 THR n 1 96 ILE n 1 97 PRO n 1 98 GLU n 1 99 ALA n 1 100 GLU n 1 101 ILE n 1 102 GLY n 1 103 LEU n 1 104 ALA n 1 105 VAL n 1 106 ILE n 1 107 ASN n 1 108 VAL n 1 109 SER n 1 110 THR n 1 111 GLU n 1 112 ILE n 1 113 TYR n 1 114 CYS n 1 115 ASN n 1 116 PRO n 1 117 ARG n 1 118 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'African clawed frog' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene NBS1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Xenopus laevis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pT7.7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 207 ? ? ? A . n A 1 2 HIS 2 208 ? ? ? A . n A 1 3 HIS 3 209 ? ? ? A . n A 1 4 HIS 4 210 ? ? ? A . n A 1 5 HIS 5 211 ? ? ? A . n A 1 6 HIS 6 212 ? ? ? A . n A 1 7 HIS 7 213 ? ? ? A . n A 1 8 MET 8 214 214 MET MET A . n A 1 9 LYS 9 215 215 LYS LYS A . n A 1 10 ARG 10 216 216 ARG ARG A . n A 1 11 LYS 11 217 217 LYS LYS A . n A 1 12 SER 12 218 218 SER SER A . n A 1 13 ILE 13 219 219 ILE ILE A . n A 1 14 PHE 14 220 220 PHE PHE A . n A 1 15 LYS 15 221 221 LYS LYS A . n A 1 16 ASP 16 222 222 ASP ASP A . n A 1 17 LYS 17 223 223 LYS LYS A . n A 1 18 VAL 18 224 224 VAL VAL A . n A 1 19 PHE 19 225 225 PHE PHE A . n A 1 20 LEU 20 226 226 LEU LEU A . n A 1 21 PHE 21 227 227 PHE PHE A . n A 1 22 LEU 22 228 228 LEU LEU A . n A 1 23 ASN 23 229 229 ASN ASN A . n A 1 24 ALA 24 230 230 ALA ALA A . n A 1 25 LYS 25 231 231 LYS LYS A . n A 1 26 GLN 26 232 232 GLN GLN A . n A 1 27 TYR 27 233 233 TYR TYR A . n A 1 28 LYS 28 234 234 LYS LYS A . n A 1 29 LYS 29 235 235 LYS LYS A . n A 1 30 LEU 30 236 236 LEU LEU A . n A 1 31 SER 31 237 237 SER SER A . n A 1 32 PRO 32 238 238 PRO PRO A . n A 1 33 ALA 33 239 239 ALA ALA A . n A 1 34 VAL 34 240 240 VAL VAL A . n A 1 35 LEU 35 241 241 LEU LEU A . n A 1 36 PHE 36 242 242 PHE PHE A . n A 1 37 GLY 37 243 243 GLY GLY A . n A 1 38 GLY 38 244 244 GLY GLY A . n A 1 39 GLY 39 245 245 GLY GLY A . n A 1 40 LYS 40 246 246 LYS LYS A . n A 1 41 THR 41 247 247 THR THR A . n A 1 42 ASP 42 248 248 ASP ASP A . n A 1 43 LEU 43 249 249 LEU LEU A . n A 1 44 LEU 44 250 250 LEU LEU A . n A 1 45 MET 45 251 251 MET MET A . n A 1 46 GLY 46 252 252 GLY GLY A . n A 1 47 GLU 47 253 253 GLU GLU A . n A 1 48 LEU 48 254 254 LEU LEU A . n A 1 49 LYS 49 255 255 LYS LYS A . n A 1 50 ASP 50 256 256 ASP ASP A . n A 1 51 ALA 51 257 257 ALA ALA A . n A 1 52 SER 52 258 258 SER SER A . n A 1 53 VAL 53 259 259 VAL VAL A . n A 1 54 LEU 54 260 260 LEU LEU A . n A 1 55 ASP 55 261 261 ASP ASP A . n A 1 56 ASN 56 262 262 ASN ASN A . n A 1 57 PRO 57 263 263 PRO PRO A . n A 1 58 ALA 58 264 264 ALA ALA A . n A 1 59 THR 59 265 265 THR THR A . n A 1 60 CYS 60 266 266 CYS CYS A . n A 1 61 VAL 61 267 267 VAL VAL A . n A 1 62 ILE 62 268 268 ILE ILE A . n A 1 63 ASP 63 269 269 ASP ASP A . n A 1 64 VAL 64 270 270 VAL VAL A . n A 1 65 ALA 65 271 271 ALA ALA A . n A 1 66 MET 66 272 272 MET MET A . n A 1 67 THR 67 273 273 THR THR A . n A 1 68 GLU 68 274 274 GLU GLU A . n A 1 69 SER 69 275 275 SER SER A . n A 1 70 GLN 70 276 276 GLN GLN A . n A 1 71 LEU 71 277 277 LEU LEU A . n A 1 72 SER 72 278 278 SER SER A . n A 1 73 GLU 73 279 279 GLU GLU A . n A 1 74 SER 74 280 280 SER SER A . n A 1 75 GLN 75 281 281 GLN GLN A . n A 1 76 SER 76 282 282 SER SER A . n A 1 77 THR 77 283 283 THR THR A . n A 1 78 GLN 78 284 284 GLN GLN A . n A 1 79 PRO 79 285 285 PRO PRO A . n A 1 80 TRP 80 286 286 TRP TRP A . n A 1 81 ILE 81 287 287 ILE ILE A . n A 1 82 THR 82 288 288 THR THR A . n A 1 83 SER 83 289 289 SER SER A . n A 1 84 THR 84 290 290 THR THR A . n A 1 85 LEU 85 291 291 LEU LEU A . n A 1 86 ASP 86 292 292 ASP ASP A . n A 1 87 LEU 87 293 293 LEU LEU A . n A 1 88 LEU 88 294 294 LEU LEU A . n A 1 89 GLN 89 295 295 GLN GLN A . n A 1 90 SER 90 296 296 SER SER A . n A 1 91 LYS 91 297 297 LYS LYS A . n A 1 92 GLY 92 298 298 GLY GLY A . n A 1 93 LEU 93 299 299 LEU LEU A . n A 1 94 ARG 94 300 300 ARG ARG A . n A 1 95 THR 95 301 301 THR THR A . n A 1 96 ILE 96 302 302 ILE ILE A . n A 1 97 PRO 97 303 303 PRO PRO A . n A 1 98 GLU 98 304 304 GLU GLU A . n A 1 99 ALA 99 305 305 ALA ALA A . n A 1 100 GLU 100 306 306 GLU GLU A . n A 1 101 ILE 101 307 307 ILE ILE A . n A 1 102 GLY 102 308 308 GLY GLY A . n A 1 103 LEU 103 309 309 LEU LEU A . n A 1 104 ALA 104 310 310 ALA ALA A . n A 1 105 VAL 105 311 311 VAL VAL A . n A 1 106 ILE 106 312 312 ILE ILE A . n A 1 107 ASN 107 313 313 ASN ASN A . n A 1 108 VAL 108 314 314 VAL VAL A . n A 1 109 SER 109 315 315 SER SER A . n A 1 110 THR 110 316 316 THR THR A . n A 1 111 GLU 111 317 317 GLU GLU A . n A 1 112 ILE 112 318 318 ILE ILE A . n A 1 113 TYR 113 319 319 TYR TYR A . n A 1 114 CYS 114 320 320 CYS CYS A . n A 1 115 ASN 115 321 321 ASN ASN A . n A 1 116 PRO 116 322 322 PRO PRO A . n A 1 117 ARG 117 323 323 ARG ARG A . n A 1 118 ARG 118 324 324 ARG ARG A . n # _cell.entry_id 2K2W _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2K2W _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K2W _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K2W _struct.title 'Second BRCT domain of NBS1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K2W _struct_keywords.pdbx_keywords 'CELL CYCLE' _struct_keywords.text 'BRCT domain, DNA repair, Cell cycle checkpoint, CELL CYCLE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6EKW1_XENLA _struct_ref.pdbx_db_accession Q6EKW1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KRKSIFKDKVFLFLNAKQYKKLSPAVLFGGGKTDLLMGELKDASVLDNPATCVIDVAMTESQLSESQSTQPWITSTLDLL QSKGLRTIPEAEIGLAVINVSTEIYCNPRR ; _struct_ref.pdbx_align_begin 215 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K2W _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 118 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6EKW1 _struct_ref_seq.db_align_beg 215 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 324 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 215 _struct_ref_seq.pdbx_auth_seq_align_end 324 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K2W MET A 1 ? UNP Q6EKW1 ? ? 'expression tag' 207 1 1 2K2W HIS A 2 ? UNP Q6EKW1 ? ? 'expression tag' 208 2 1 2K2W HIS A 3 ? UNP Q6EKW1 ? ? 'expression tag' 209 3 1 2K2W HIS A 4 ? UNP Q6EKW1 ? ? 'expression tag' 210 4 1 2K2W HIS A 5 ? UNP Q6EKW1 ? ? 'expression tag' 211 5 1 2K2W HIS A 6 ? UNP Q6EKW1 ? ? 'expression tag' 212 6 1 2K2W HIS A 7 ? UNP Q6EKW1 ? ? 'expression tag' 213 7 1 2K2W MET A 8 ? UNP Q6EKW1 ? ? 'expression tag' 214 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 26 ? GLY A 37 ? GLN A 232 GLY A 243 1 ? 12 HELX_P HELX_P2 2 GLY A 46 ? ASP A 50 ? GLY A 252 ASP A 256 5 ? 5 HELX_P HELX_P3 3 ALA A 51 ? ASN A 56 ? ALA A 257 ASN A 262 1 ? 6 HELX_P HELX_P4 4 ALA A 65 ? SER A 69 ? ALA A 271 SER A 275 5 ? 5 HELX_P HELX_P5 5 GLN A 70 ? SER A 74 ? GLN A 276 SER A 280 5 ? 5 HELX_P HELX_P6 6 THR A 82 ? GLY A 92 ? THR A 288 GLY A 298 1 ? 11 HELX_P HELX_P7 7 GLU A 98 ? VAL A 108 ? GLU A 304 VAL A 314 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 40 ? ASP A 42 ? LYS A 246 ASP A 248 A 2 VAL A 18 ? PHE A 21 ? VAL A 224 PHE A 227 A 3 THR A 59 ? ASP A 63 ? THR A 265 ASP A 269 A 4 THR A 95 ? PRO A 97 ? THR A 301 PRO A 303 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ASP A 42 ? O ASP A 248 N PHE A 21 ? N PHE A 227 A 2 3 N LEU A 20 ? N LEU A 226 O ILE A 62 ? O ILE A 268 A 3 4 N VAL A 61 ? N VAL A 267 O ILE A 96 ? O ILE A 302 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 218 ? ? -141.58 47.65 2 1 LEU A 228 ? ? -81.54 31.45 3 1 LYS A 231 ? ? -124.50 -60.12 4 1 ALA A 264 ? ? -142.63 12.70 5 1 ALA A 271 ? ? -69.61 45.73 6 1 GLU A 279 ? ? -150.10 27.14 7 1 SER A 315 ? ? -142.97 49.37 8 2 LYS A 221 ? ? 39.51 -103.51 9 2 MET A 251 ? ? -148.69 33.90 10 2 GLU A 253 ? ? 55.86 -13.46 11 2 ALA A 264 ? ? 48.91 26.54 12 2 ALA A 271 ? ? -141.77 26.20 13 2 GLU A 279 ? ? -147.32 -45.94 14 2 GLN A 284 ? ? -156.06 -53.99 15 2 GLU A 317 ? ? -127.22 -56.88 16 2 ARG A 323 ? ? -139.38 -39.29 17 3 PHE A 220 ? ? -141.85 27.49 18 3 MET A 251 ? ? -150.01 36.48 19 3 LEU A 254 ? ? -75.63 44.33 20 3 ASP A 261 ? ? -131.39 -36.47 21 3 ALA A 264 ? ? -144.87 31.43 22 3 VAL A 270 ? ? -92.94 35.41 23 3 LEU A 277 ? ? -23.22 105.29 24 3 THR A 316 ? ? -69.85 28.48 25 3 ILE A 318 ? ? -133.78 -31.18 26 3 ARG A 323 ? ? -140.24 -39.04 27 4 ASP A 222 ? ? -91.05 58.96 28 4 LEU A 228 ? ? -79.98 20.12 29 4 LEU A 254 ? ? -64.48 2.16 30 4 ALA A 264 ? ? -146.22 20.98 31 4 ILE A 287 ? ? -79.22 33.05 32 4 THR A 316 ? ? -69.40 65.75 33 4 GLU A 317 ? ? -127.37 -53.96 34 4 ILE A 318 ? ? -132.84 -37.08 35 4 ARG A 323 ? ? -134.13 -35.85 36 5 LYS A 215 ? ? -156.22 -38.30 37 5 SER A 218 ? ? -148.47 27.37 38 5 MET A 251 ? ? -147.65 32.37 39 5 ASP A 261 ? ? -134.88 -35.90 40 5 ALA A 264 ? ? -145.37 32.48 41 5 THR A 283 ? ? -141.15 39.14 42 5 SER A 315 ? ? -142.59 30.65 43 5 ILE A 318 ? ? -131.40 -30.02 44 5 ARG A 323 ? ? -133.02 -40.42 45 6 LYS A 215 ? ? 67.72 -33.76 46 6 SER A 218 ? ? -143.49 27.54 47 6 PHE A 220 ? ? -140.98 39.17 48 6 LEU A 228 ? ? -75.53 23.37 49 6 LYS A 231 ? ? -131.68 -48.94 50 6 MET A 251 ? ? -140.07 -34.33 51 6 ILE A 318 ? ? -137.09 -38.88 52 6 ARG A 323 ? ? -136.19 -34.22 53 7 LYS A 217 ? ? -127.16 -58.27 54 7 LYS A 231 ? ? -122.31 -53.38 55 7 MET A 251 ? ? -138.93 -34.05 56 7 LEU A 254 ? ? 31.10 51.58 57 7 ALA A 264 ? ? -142.26 28.87 58 7 GLU A 279 ? ? -140.78 -17.93 59 7 GLN A 281 ? ? 61.52 178.59 60 7 THR A 288 ? ? -140.64 56.71 61 7 ILE A 318 ? ? -130.63 -31.05 62 7 CYS A 320 ? ? -116.22 61.57 63 7 ARG A 323 ? ? -130.10 -40.49 64 8 LYS A 217 ? ? -145.56 58.11 65 8 PHE A 220 ? ? -142.02 25.38 66 8 LEU A 228 ? ? -78.74 25.25 67 8 LYS A 231 ? ? -134.73 -55.99 68 8 LEU A 254 ? ? -59.05 103.18 69 8 ALA A 264 ? ? -142.60 30.96 70 8 ALA A 271 ? ? 56.97 13.93 71 8 THR A 273 ? ? -145.20 -51.87 72 8 GLU A 274 ? ? 63.22 -40.36 73 8 SER A 315 ? ? -140.45 35.34 74 8 GLU A 317 ? ? -126.70 -55.89 75 8 CYS A 320 ? ? -142.60 51.00 76 8 ARG A 323 ? ? -134.88 -35.24 77 9 ARG A 216 ? ? -66.69 0.49 78 9 PHE A 220 ? ? -143.46 36.74 79 9 LEU A 228 ? ? -93.68 35.84 80 9 LYS A 231 ? ? -130.75 -49.34 81 9 MET A 251 ? ? -155.02 66.23 82 9 ALA A 264 ? ? -142.63 22.85 83 9 MET A 272 ? ? 62.84 169.25 84 9 THR A 316 ? ? -68.25 76.42 85 9 GLU A 317 ? ? -132.40 -58.95 86 10 ARG A 216 ? ? -148.69 -43.49 87 10 LYS A 217 ? ? -134.87 -78.65 88 10 PHE A 220 ? ? -140.47 26.39 89 10 ALA A 264 ? ? 49.20 29.48 90 10 MET A 272 ? ? -86.02 42.19 91 10 TRP A 286 ? ? 40.57 -122.28 92 10 ILE A 318 ? ? -131.57 -32.90 93 11 ARG A 216 ? ? 56.06 10.77 94 11 SER A 218 ? ? -64.81 83.26 95 11 LYS A 231 ? ? -125.60 -61.01 96 11 GLU A 253 ? ? 63.96 -30.58 97 11 ALA A 264 ? ? -144.05 30.45 98 11 SER A 289 ? ? -146.31 -4.13 99 11 THR A 316 ? ? -69.75 78.34 100 11 GLU A 317 ? ? -126.01 -65.32 101 11 ARG A 323 ? ? -139.33 -39.54 102 12 SER A 218 ? ? -73.94 39.07 103 12 PHE A 220 ? ? -142.10 33.75 104 12 LEU A 228 ? ? -97.93 38.43 105 12 LYS A 231 ? ? -127.96 -50.21 106 12 MET A 251 ? ? -155.19 30.16 107 12 LEU A 254 ? ? -75.75 43.52 108 12 THR A 273 ? ? 49.51 25.98 109 12 ILE A 318 ? ? -132.35 -31.94 110 13 LYS A 231 ? ? -122.24 -54.79 111 13 MET A 251 ? ? -149.08 30.08 112 13 GLU A 253 ? ? 64.60 -45.31 113 13 ASP A 261 ? ? -131.30 -37.47 114 13 ALA A 264 ? ? -141.78 34.24 115 13 TRP A 286 ? ? -159.15 -68.18 116 13 THR A 316 ? ? -68.84 73.31 117 13 GLU A 317 ? ? -130.72 -61.49 118 14 PHE A 220 ? ? -145.86 28.31 119 14 ASP A 222 ? ? -104.53 47.87 120 14 ALA A 264 ? ? -146.10 12.39 121 14 THR A 273 ? ? -66.06 2.89 122 14 SER A 275 ? ? -139.01 -54.72 123 14 GLU A 279 ? ? -152.52 -37.03 124 15 LYS A 215 ? ? -140.94 16.38 125 15 SER A 218 ? ? -72.97 30.35 126 15 LYS A 231 ? ? -128.40 -55.68 127 15 MET A 251 ? ? -151.97 19.41 128 15 ALA A 257 ? ? 63.33 -19.22 129 15 ASP A 261 ? ? -133.93 -33.68 130 15 ALA A 264 ? ? -143.23 24.70 131 15 SER A 278 ? ? 49.17 28.03 132 15 SER A 315 ? ? -140.32 49.68 133 15 THR A 316 ? ? -65.69 77.44 134 15 GLU A 317 ? ? -128.83 -57.97 135 15 CYS A 320 ? ? -141.26 56.12 136 16 PHE A 220 ? ? -140.77 38.17 137 16 ALA A 264 ? ? -145.19 13.00 138 16 MET A 272 ? ? 58.70 17.50 139 16 SER A 315 ? ? -142.30 39.26 140 16 THR A 316 ? ? -69.92 74.31 141 16 GLU A 317 ? ? -129.94 -60.12 142 17 SER A 218 ? ? -73.35 43.61 143 17 LYS A 231 ? ? -127.20 -57.90 144 17 LEU A 254 ? ? -59.06 105.78 145 17 GLU A 274 ? ? -141.45 -50.00 146 17 SER A 278 ? ? -142.89 29.49 147 17 ARG A 323 ? ? -169.73 -33.44 148 18 LYS A 231 ? ? -128.83 -52.89 149 18 LEU A 254 ? ? 31.91 56.98 150 18 ALA A 264 ? ? -144.97 32.74 151 18 ALA A 271 ? ? -141.68 50.70 152 18 SER A 275 ? ? 59.29 16.26 153 18 SER A 282 ? ? 46.67 -145.53 154 18 SER A 315 ? ? -142.10 40.06 155 18 THR A 316 ? ? -69.62 79.82 156 18 GLU A 317 ? ? -131.70 -61.08 157 18 ILE A 318 ? ? -132.75 -36.50 158 18 ARG A 323 ? ? -133.54 -38.22 159 19 PHE A 220 ? ? -141.85 43.79 160 19 ASP A 222 ? ? 45.92 28.72 161 19 MET A 251 ? ? -146.58 58.68 162 19 LEU A 254 ? ? -74.82 49.31 163 19 ALA A 264 ? ? -145.79 28.97 164 19 ALA A 271 ? ? -153.79 23.02 165 19 SER A 278 ? ? -73.21 34.15 166 19 SER A 282 ? ? -68.59 3.82 167 19 THR A 283 ? ? -69.61 20.46 168 19 ARG A 323 ? ? -132.09 -36.76 169 20 SER A 218 ? ? -142.00 24.63 170 20 PHE A 220 ? ? -146.01 31.71 171 20 MET A 251 ? ? -147.43 17.68 172 20 GLU A 253 ? ? 65.35 -35.66 173 20 ALA A 264 ? ? -143.01 30.20 174 20 GLU A 279 ? ? -155.07 -47.70 175 20 SER A 280 ? ? -69.35 98.97 176 20 GLN A 281 ? ? 62.07 172.82 177 20 ARG A 323 ? ? -130.63 -35.02 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K2W _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K2W _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '20 mM sodium phosphate, 50 mM sodium chloride, 50 mM glutamic acid, 50 mM arginine, 0.3-0.5 mM [U-100% 15N] protein, 93% H2O/7% D2O' 1 '93% H2O/7% D2O' ;20 mM sodium phosphate, 50 mM sodium chloride, 50 mM glutamic acid, 50 mM arginine, 0.3-0.5 mM [U-100% 13C; U-100% 15N] protein, 93% H2O/7% D2O ; 2 '93% H2O/7% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate' 20 mM ? 1 'sodium chloride' 50 mM ? 1 'glutamic acid' 50 mM ? 1 arginine 50 mM ? 1 entity 0.3 mM '[U-100% 15N]' 1 'sodium phosphate' 20 mM ? 2 'sodium chloride' 50 mM ? 2 'glutamic acid' 50 mM ? 2 arginine 50 mM ? 2 entity 0.3 mM '[U-100% 13C; U-100% 15N]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 2 '3D CBCA(CO)NH' 1 4 2 '3D HNCACB' 1 5 2 '3D HBHA(CO)NH' 1 6 2 '3D HNCO' 1 7 2 '3D HCACO' 1 8 2 '3D H(CCO)NH' 1 9 2 '3D C(CO)NH' 1 10 2 '3D HNCACB' 1 11 2 '3D HCCH-COSY' 1 12 2 '3D CCH-COSY' 1 13 2 '3D CCH-TOCSY' 1 14 1 '3D 1H-15N NOESY' 1 15 1 '3D 1H-15N TOCSY' 1 16 2 '3D 1H-13C NOESY aliphatic' 1 17 2 '2D HBCBCGCDHD' 1 18 2 '3D 1H-13C AROMATIC' # _pdbx_nmr_refine.entry_id 2K2W _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 1 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' refinement Amber 8.0 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRPipe ? 3 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 4 Wishart 'data analysis' TALOS ? 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 207 ? A MET 1 2 1 Y 1 A HIS 208 ? A HIS 2 3 1 Y 1 A HIS 209 ? A HIS 3 4 1 Y 1 A HIS 210 ? A HIS 4 5 1 Y 1 A HIS 211 ? A HIS 5 6 1 Y 1 A HIS 212 ? A HIS 6 7 1 Y 1 A HIS 213 ? A HIS 7 8 2 Y 1 A MET 207 ? A MET 1 9 2 Y 1 A HIS 208 ? A HIS 2 10 2 Y 1 A HIS 209 ? A HIS 3 11 2 Y 1 A HIS 210 ? A HIS 4 12 2 Y 1 A HIS 211 ? A HIS 5 13 2 Y 1 A HIS 212 ? A HIS 6 14 2 Y 1 A HIS 213 ? A HIS 7 15 3 Y 1 A MET 207 ? A MET 1 16 3 Y 1 A HIS 208 ? A HIS 2 17 3 Y 1 A HIS 209 ? A HIS 3 18 3 Y 1 A HIS 210 ? A HIS 4 19 3 Y 1 A HIS 211 ? A HIS 5 20 3 Y 1 A HIS 212 ? A HIS 6 21 3 Y 1 A HIS 213 ? A HIS 7 22 4 Y 1 A MET 207 ? A MET 1 23 4 Y 1 A HIS 208 ? A HIS 2 24 4 Y 1 A HIS 209 ? A HIS 3 25 4 Y 1 A HIS 210 ? A HIS 4 26 4 Y 1 A HIS 211 ? A HIS 5 27 4 Y 1 A HIS 212 ? A HIS 6 28 4 Y 1 A HIS 213 ? A HIS 7 29 5 Y 1 A MET 207 ? A MET 1 30 5 Y 1 A HIS 208 ? A HIS 2 31 5 Y 1 A HIS 209 ? A HIS 3 32 5 Y 1 A HIS 210 ? A HIS 4 33 5 Y 1 A HIS 211 ? A HIS 5 34 5 Y 1 A HIS 212 ? A HIS 6 35 5 Y 1 A HIS 213 ? A HIS 7 36 6 Y 1 A MET 207 ? A MET 1 37 6 Y 1 A HIS 208 ? A HIS 2 38 6 Y 1 A HIS 209 ? A HIS 3 39 6 Y 1 A HIS 210 ? A HIS 4 40 6 Y 1 A HIS 211 ? A HIS 5 41 6 Y 1 A HIS 212 ? A HIS 6 42 6 Y 1 A HIS 213 ? A HIS 7 43 7 Y 1 A MET 207 ? A MET 1 44 7 Y 1 A HIS 208 ? A HIS 2 45 7 Y 1 A HIS 209 ? A HIS 3 46 7 Y 1 A HIS 210 ? A HIS 4 47 7 Y 1 A HIS 211 ? A HIS 5 48 7 Y 1 A HIS 212 ? A HIS 6 49 7 Y 1 A HIS 213 ? A HIS 7 50 8 Y 1 A MET 207 ? A MET 1 51 8 Y 1 A HIS 208 ? A HIS 2 52 8 Y 1 A HIS 209 ? A HIS 3 53 8 Y 1 A HIS 210 ? A HIS 4 54 8 Y 1 A HIS 211 ? A HIS 5 55 8 Y 1 A HIS 212 ? A HIS 6 56 8 Y 1 A HIS 213 ? A HIS 7 57 9 Y 1 A MET 207 ? A MET 1 58 9 Y 1 A HIS 208 ? A HIS 2 59 9 Y 1 A HIS 209 ? A HIS 3 60 9 Y 1 A HIS 210 ? A HIS 4 61 9 Y 1 A HIS 211 ? A HIS 5 62 9 Y 1 A HIS 212 ? A HIS 6 63 9 Y 1 A HIS 213 ? A HIS 7 64 10 Y 1 A MET 207 ? A MET 1 65 10 Y 1 A HIS 208 ? A HIS 2 66 10 Y 1 A HIS 209 ? A HIS 3 67 10 Y 1 A HIS 210 ? A HIS 4 68 10 Y 1 A HIS 211 ? A HIS 5 69 10 Y 1 A HIS 212 ? A HIS 6 70 10 Y 1 A HIS 213 ? A HIS 7 71 11 Y 1 A MET 207 ? A MET 1 72 11 Y 1 A HIS 208 ? A HIS 2 73 11 Y 1 A HIS 209 ? A HIS 3 74 11 Y 1 A HIS 210 ? A HIS 4 75 11 Y 1 A HIS 211 ? A HIS 5 76 11 Y 1 A HIS 212 ? A HIS 6 77 11 Y 1 A HIS 213 ? A HIS 7 78 12 Y 1 A MET 207 ? A MET 1 79 12 Y 1 A HIS 208 ? A HIS 2 80 12 Y 1 A HIS 209 ? A HIS 3 81 12 Y 1 A HIS 210 ? A HIS 4 82 12 Y 1 A HIS 211 ? A HIS 5 83 12 Y 1 A HIS 212 ? A HIS 6 84 12 Y 1 A HIS 213 ? A HIS 7 85 13 Y 1 A MET 207 ? A MET 1 86 13 Y 1 A HIS 208 ? A HIS 2 87 13 Y 1 A HIS 209 ? A HIS 3 88 13 Y 1 A HIS 210 ? A HIS 4 89 13 Y 1 A HIS 211 ? A HIS 5 90 13 Y 1 A HIS 212 ? A HIS 6 91 13 Y 1 A HIS 213 ? A HIS 7 92 14 Y 1 A MET 207 ? A MET 1 93 14 Y 1 A HIS 208 ? A HIS 2 94 14 Y 1 A HIS 209 ? A HIS 3 95 14 Y 1 A HIS 210 ? A HIS 4 96 14 Y 1 A HIS 211 ? A HIS 5 97 14 Y 1 A HIS 212 ? A HIS 6 98 14 Y 1 A HIS 213 ? A HIS 7 99 15 Y 1 A MET 207 ? A MET 1 100 15 Y 1 A HIS 208 ? A HIS 2 101 15 Y 1 A HIS 209 ? A HIS 3 102 15 Y 1 A HIS 210 ? A HIS 4 103 15 Y 1 A HIS 211 ? A HIS 5 104 15 Y 1 A HIS 212 ? A HIS 6 105 15 Y 1 A HIS 213 ? A HIS 7 106 16 Y 1 A MET 207 ? A MET 1 107 16 Y 1 A HIS 208 ? A HIS 2 108 16 Y 1 A HIS 209 ? A HIS 3 109 16 Y 1 A HIS 210 ? A HIS 4 110 16 Y 1 A HIS 211 ? A HIS 5 111 16 Y 1 A HIS 212 ? A HIS 6 112 16 Y 1 A HIS 213 ? A HIS 7 113 17 Y 1 A MET 207 ? A MET 1 114 17 Y 1 A HIS 208 ? A HIS 2 115 17 Y 1 A HIS 209 ? A HIS 3 116 17 Y 1 A HIS 210 ? A HIS 4 117 17 Y 1 A HIS 211 ? A HIS 5 118 17 Y 1 A HIS 212 ? A HIS 6 119 17 Y 1 A HIS 213 ? A HIS 7 120 18 Y 1 A MET 207 ? A MET 1 121 18 Y 1 A HIS 208 ? A HIS 2 122 18 Y 1 A HIS 209 ? A HIS 3 123 18 Y 1 A HIS 210 ? A HIS 4 124 18 Y 1 A HIS 211 ? A HIS 5 125 18 Y 1 A HIS 212 ? A HIS 6 126 18 Y 1 A HIS 213 ? A HIS 7 127 19 Y 1 A MET 207 ? A MET 1 128 19 Y 1 A HIS 208 ? A HIS 2 129 19 Y 1 A HIS 209 ? A HIS 3 130 19 Y 1 A HIS 210 ? A HIS 4 131 19 Y 1 A HIS 211 ? A HIS 5 132 19 Y 1 A HIS 212 ? A HIS 6 133 19 Y 1 A HIS 213 ? A HIS 7 134 20 Y 1 A MET 207 ? A MET 1 135 20 Y 1 A HIS 208 ? A HIS 2 136 20 Y 1 A HIS 209 ? A HIS 3 137 20 Y 1 A HIS 210 ? A HIS 4 138 20 Y 1 A HIS 211 ? A HIS 5 139 20 Y 1 A HIS 212 ? A HIS 6 140 20 Y 1 A HIS 213 ? A HIS 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 700 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2K2W _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_