data_2K2X # _entry.id 2K2X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K2X pdb_00002k2x 10.2210/pdb2k2x/pdb RCSB RCSB100608 ? ? WWPDB D_1000100608 ? ? BMRB 15729 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2K2Y unspecified . PDB 2K2Z unspecified . BMRB 15729 unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K2X _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-04-15 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pantoja-Uceda, D.' 1 'Blanco, F.' 2 # _citation.id primary _citation.title ;The NMR structures of the major intermediates of the two-domain tick carboxypeptidase inhibitor reveal symmetry in its folding and unfolding pathways. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 283 _citation.page_first 27110 _citation.page_last 27120 _citation.year 2008 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18640980 _citation.pdbx_database_id_DOI 10.1074/jbc.M803978200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Arolas, J.L.' 1 ? primary 'Pantoja-Uceda, D.' 2 ? primary 'Ventura, S.' 3 ? primary 'Blanco, F.J.' 4 ? primary 'Aviles, F.X.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Carboxypeptidase inhibitor' _entity.formula_weight 7945.104 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name TCI # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code NECVSKGFGCLPQSDCPQEARLSYGGCSTVCCDLSKLTGCKGKGGECNPLDRQCKELQAESASCGKGQKCCVWLH _entity_poly.pdbx_seq_one_letter_code_can NECVSKGFGCLPQSDCPQEARLSYGGCSTVCCDLSKLTGCKGKGGECNPLDRQCKELQAESASCGKGQKCCVWLH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 GLU n 1 3 CYS n 1 4 VAL n 1 5 SER n 1 6 LYS n 1 7 GLY n 1 8 PHE n 1 9 GLY n 1 10 CYS n 1 11 LEU n 1 12 PRO n 1 13 GLN n 1 14 SER n 1 15 ASP n 1 16 CYS n 1 17 PRO n 1 18 GLN n 1 19 GLU n 1 20 ALA n 1 21 ARG n 1 22 LEU n 1 23 SER n 1 24 TYR n 1 25 GLY n 1 26 GLY n 1 27 CYS n 1 28 SER n 1 29 THR n 1 30 VAL n 1 31 CYS n 1 32 CYS n 1 33 ASP n 1 34 LEU n 1 35 SER n 1 36 LYS n 1 37 LEU n 1 38 THR n 1 39 GLY n 1 40 CYS n 1 41 LYS n 1 42 GLY n 1 43 LYS n 1 44 GLY n 1 45 GLY n 1 46 GLU n 1 47 CYS n 1 48 ASN n 1 49 PRO n 1 50 LEU n 1 51 ASP n 1 52 ARG n 1 53 GLN n 1 54 CYS n 1 55 LYS n 1 56 GLU n 1 57 LEU n 1 58 GLN n 1 59 ALA n 1 60 GLU n 1 61 SER n 1 62 ALA n 1 63 SER n 1 64 CYS n 1 65 GLY n 1 66 LYS n 1 67 GLY n 1 68 GLN n 1 69 LYS n 1 70 CYS n 1 71 CYS n 1 72 VAL n 1 73 TRP n 1 74 LEU n 1 75 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Tick _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rhipicephalus bursa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector pBAT-4-OmpA _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TCI1_RHIBU _struct_ref.pdbx_db_accession Q5EPH2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NECVSKGFGCLPQSDCPQEARLSYGGCSTVCCDLSKLTGCKGKGGECNPLDRQCKELQAESASCGKGQKCCVWLH _struct_ref.pdbx_align_begin 23 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K2X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5EPH2 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 97 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 3.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.00 mM TCI, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2K2X _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;Standard CYANA protocol of NOE assignment and structure calculation. The 20 conformers with the lowest final CYANA target function values were subject to restrained energy-minimization in explicit water using AMBER 9.0 ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K2X _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K2X _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Johnson, One Moon Scientific' 'peak picking' NMRView 5.0.4 1 'Johnson, One Moon Scientific' 'data analysis' NMRView 5.0.4 2 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 3 'Bruker Biospin' collection XwinNMR ? 4 'Bruker Biospin' processing XwinNMR ? 5 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K2X _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K2X _struct.title 'Solution Structure of Tick Carboxypeptidase Inhibitor at pH 3.5' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K2X _struct_keywords.pdbx_keywords 'HYDROLASE INHIBITOR' _struct_keywords.text 'TCI, Blood coagulation, Fibrinolysis, Metalloenzyme inhibitor, Metalloprotease inhibitor, Secreted, HYDROLASE INHIBITOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 2 ? GLY A 7 ? GLU A 2 GLY A 7 1 ? 6 HELX_P HELX_P2 2 GLY A 39 ? LYS A 43 ? GLY A 39 LYS A 43 5 ? 5 HELX_P HELX_P3 3 GLU A 60 ? CYS A 64 ? GLU A 60 CYS A 64 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 3 A CYS 31 1_555 ? ? ? ? ? ? ? 2.023 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 10 A CYS 27 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf3 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 16 A CYS 32 1_555 ? ? ? ? ? ? ? 2.038 ? ? disulf4 disulf ? ? A CYS 40 SG ? ? ? 1_555 A CYS 70 SG ? ? A CYS 40 A CYS 70 1_555 ? ? ? ? ? ? ? 2.046 ? ? disulf5 disulf ? ? A CYS 47 SG ? ? ? 1_555 A CYS 64 SG ? ? A CYS 47 A CYS 64 1_555 ? ? ? ? ? ? ? 2.038 ? ? disulf6 disulf ? ? A CYS 54 SG ? ? ? 1_555 A CYS 71 SG ? ? A CYS 54 A CYS 71 1_555 ? ? ? ? ? ? ? 2.034 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 46 ? ASN A 48 ? GLU A 46 ASN A 48 A 2 LYS A 69 ? CYS A 71 ? LYS A 69 CYS A 71 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 46 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 46 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id CYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 71 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 71 # _atom_sites.entry_id 2K2X _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 1 1 ASN ASN A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 CYS 71 71 71 CYS CYS A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 HIS 75 75 75 HIS HIS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-01-27 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' pdbx_struct_assembly 6 3 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.component TCI _pdbx_nmr_exptl_sample.concentration 1.00 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 29 ? ? -142.10 -73.02 2 1 THR A 38 ? ? -98.57 -80.55 3 1 CYS A 54 ? ? -144.59 -91.54 4 1 GLU A 60 ? ? -137.24 -49.42 5 1 GLN A 68 ? ? -75.10 36.40 6 2 THR A 29 ? ? -138.01 -69.71 7 2 THR A 38 ? ? -101.58 -97.92 8 2 ALA A 59 ? ? -77.37 -82.46 9 3 CYS A 10 ? ? -119.08 63.38 10 3 THR A 29 ? ? -138.40 -66.81 11 3 ASP A 33 ? ? -69.75 99.32 12 3 GLU A 60 ? ? -139.17 -37.68 13 4 THR A 29 ? ? -131.60 -75.42 14 4 THR A 38 ? ? -122.60 -69.63 15 4 LYS A 41 ? ? 73.15 -4.11 16 4 LYS A 43 ? ? -134.98 -36.88 17 4 ASN A 48 ? ? 55.68 171.03 18 4 CYS A 64 ? ? -67.27 -83.41 19 4 GLN A 68 ? ? 38.55 25.63 20 5 THR A 29 ? ? -141.60 -72.57 21 5 THR A 38 ? ? 36.78 82.49 22 5 ALA A 59 ? ? -76.86 -70.86 23 6 THR A 29 ? ? -142.37 -66.39 24 6 ASP A 33 ? ? -66.71 99.68 25 6 ASN A 48 ? ? -46.72 150.25 26 6 CYS A 71 ? ? -164.99 13.62 27 6 LEU A 74 ? ? -114.82 -71.75 28 7 CYS A 10 ? ? 34.34 61.92 29 7 THR A 29 ? ? -138.32 -71.98 30 7 LYS A 41 ? ? -139.26 -32.76 31 7 ALA A 59 ? ? -67.29 -70.20 32 8 PHE A 8 ? ? -95.28 -102.26 33 8 THR A 29 ? ? -137.54 -69.61 34 8 ASN A 48 ? ? -43.90 153.02 35 8 LYS A 66 ? ? -76.03 46.42 36 8 CYS A 71 ? ? -158.17 4.66 37 9 GLU A 2 ? ? -73.89 -75.30 38 9 CYS A 10 ? ? 37.54 53.93 39 9 THR A 29 ? ? -143.08 -70.83 40 9 THR A 38 ? ? -110.16 -75.69 41 9 CYS A 47 ? ? -101.28 44.96 42 9 GLU A 60 ? ? -139.32 -37.00 43 10 TYR A 24 ? ? -63.06 -100.71 44 10 THR A 29 ? ? -136.77 -67.79 45 10 ASP A 33 ? ? -69.96 96.89 46 10 LYS A 41 ? ? 52.93 17.74 47 10 CYS A 47 ? ? -74.68 25.09 48 10 GLU A 60 ? ? -138.34 -36.71 49 10 SER A 61 ? ? -90.12 48.47 50 10 CYS A 64 ? ? -141.12 -55.72 51 10 CYS A 71 ? ? -158.97 85.86 52 11 ASP A 15 ? ? -87.37 -70.08 53 11 THR A 29 ? ? -142.94 -71.07 54 11 ASP A 33 ? ? -69.83 86.18 55 11 LYS A 43 ? ? -77.79 -77.37 56 11 LYS A 66 ? ? -74.83 46.46 57 11 CYS A 70 ? ? -52.64 109.00 58 12 THR A 29 ? ? -139.36 -72.64 59 12 LYS A 41 ? ? -133.34 -49.58 60 12 GLN A 53 ? ? -68.15 99.22 61 12 GLU A 60 ? ? -138.25 -56.78 62 12 ALA A 62 ? ? -59.63 -6.65 63 12 CYS A 64 ? ? -71.40 -75.69 64 13 THR A 29 ? ? -138.75 -74.63 65 13 LYS A 41 ? ? -137.40 -31.03 66 13 LYS A 43 ? ? -131.38 -65.87 67 13 LYS A 66 ? ? -54.76 107.56 68 13 CYS A 70 ? ? -66.89 96.77 69 14 ASP A 15 ? ? -97.39 -66.27 70 14 THR A 29 ? ? -138.95 -70.68 71 14 ASP A 33 ? ? -67.38 99.83 72 14 ALA A 59 ? ? -129.30 -71.89 73 15 CYS A 10 ? ? -113.62 78.84 74 15 THR A 29 ? ? -137.69 -74.78 75 15 LYS A 41 ? ? -142.90 -73.65 76 15 CYS A 47 ? ? -95.80 33.91 77 15 CYS A 54 ? ? -149.39 -87.73 78 15 LEU A 57 ? ? -169.23 109.92 79 15 LYS A 66 ? ? -77.13 41.33 80 15 LYS A 69 ? ? -167.66 119.94 81 16 GLU A 2 ? ? -121.96 -51.37 82 16 THR A 29 ? ? -140.90 -67.71 83 16 THR A 38 ? ? -113.61 -70.48 84 16 LYS A 41 ? ? 58.99 15.60 85 16 CYS A 54 ? ? -63.58 -87.83 86 16 LYS A 66 ? ? -76.33 45.30 87 17 THR A 29 ? ? -137.33 -71.83 88 17 THR A 38 ? ? 28.46 81.90 89 17 ALA A 59 ? ? -81.09 -78.33 90 18 THR A 29 ? ? -139.64 -74.04 91 18 THR A 38 ? ? -141.28 -47.47 92 18 ALA A 59 ? ? -73.29 -71.91 93 18 TRP A 73 ? ? 58.98 19.01 94 19 THR A 29 ? ? -137.16 -72.19 95 19 LYS A 41 ? ? 48.13 29.00 96 19 ALA A 59 ? ? -121.75 -87.10 97 20 CYS A 10 ? ? -118.71 69.17 98 20 THR A 29 ? ? -138.64 -74.25 99 20 ASP A 33 ? ? -67.48 93.13 100 20 LYS A 41 ? ? 55.79 15.30 101 20 ARG A 52 ? ? -74.78 33.13 102 20 GLN A 53 ? ? 65.28 -8.69 103 20 GLU A 60 ? ? -135.07 -42.66 104 20 LYS A 66 ? ? -65.47 99.86 #