data_2K35 # _entry.id 2K35 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K35 pdb_00002k35 10.2210/pdb2k35/pdb RCSB RCSB100616 ? ? WWPDB D_1000100616 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-11-18 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_entry_details 7 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K35 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-04-22 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 15739 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jung, S.' 1 'Dingley, A.J.' 2 'Stanisak, M.' 3 'Gelhaus, C.' 4 'Bosch, T.' 5 'Podschun, R.' 6 'Leippe, M.' 7 'Gr tzinger, J.' 8 # _citation.id primary _citation.title 'Hydramacin-1, structure and antibacterial activity of a protein from the Basal metazoan hydra.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 284 _citation.page_first 1896 _citation.page_last 1905 _citation.year 2009 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19019828 _citation.pdbx_database_id_DOI 10.1074/jbc.M804713200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jung, S.' 1 ? primary 'Dingley, A.J.' 2 ? primary 'Augustin, R.' 3 ? primary 'Anton-Erxleben, F.' 4 ? primary 'Stanisak, M.' 5 ? primary 'Gelhaus, C.' 6 ? primary 'Gutsmann, T.' 7 ? primary 'Hammer, M.U.' 8 ? primary 'Podschun, R.' 9 ? primary 'Bonvin, A.M.' 10 ? primary 'Leippe, M.' 11 ? primary 'Bosch, T.C.' 12 ? primary 'Grotzinger, J.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description hydramacin-1 _entity.formula_weight 7029.120 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code QIVDCWETWSRCTKWSQGGTGTLWKSCNDRCKELGRKRGQCEEKPSRCPLSKKAWTCICY _entity_poly.pdbx_seq_one_letter_code_can QIVDCWETWSRCTKWSQGGTGTLWKSCNDRCKELGRKRGQCEEKPSRCPLSKKAWTCICY _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 ILE n 1 3 VAL n 1 4 ASP n 1 5 CYS n 1 6 TRP n 1 7 GLU n 1 8 THR n 1 9 TRP n 1 10 SER n 1 11 ARG n 1 12 CYS n 1 13 THR n 1 14 LYS n 1 15 TRP n 1 16 SER n 1 17 GLN n 1 18 GLY n 1 19 GLY n 1 20 THR n 1 21 GLY n 1 22 THR n 1 23 LEU n 1 24 TRP n 1 25 LYS n 1 26 SER n 1 27 CYS n 1 28 ASN n 1 29 ASP n 1 30 ARG n 1 31 CYS n 1 32 LYS n 1 33 GLU n 1 34 LEU n 1 35 GLY n 1 36 ARG n 1 37 LYS n 1 38 ARG n 1 39 GLY n 1 40 GLN n 1 41 CYS n 1 42 GLU n 1 43 GLU n 1 44 LYS n 1 45 PRO n 1 46 SER n 1 47 ARG n 1 48 CYS n 1 49 PRO n 1 50 LEU n 1 51 SER n 1 52 LYS n 1 53 LYS n 1 54 ALA n 1 55 TRP n 1 56 THR n 1 57 CYS n 1 58 ILE n 1 59 CYS n 1 60 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name Hydra _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector pET32a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 1 GLN GLN A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 TRP 15 15 15 TRP TRP A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 TRP 55 55 55 TRP TRP A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 TYR 60 60 60 TYR TYR A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K35 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K35 _struct.title 'Hydramacin-1: Structure and antibacterial activity of a peptide from the basal metazoan Hydra' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K35 _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' _struct_keywords.text 'ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2K35 _struct_ref.pdbx_db_accession 2K35 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code QIVDCWETWSRCTKWSQGGTGTLWKSCNDRCKELGRKRGQCEEKPSRCPLSKKAWTCICY _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K35 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 60 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2K35 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 60 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 60 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 8 ? TRP A 15 ? THR A 8 TRP A 15 1 ? 8 HELX_P HELX_P2 2 LYS A 25 ? GLU A 33 ? LYS A 25 GLU A 33 1 ? 9 HELX_P HELX_P3 3 PRO A 45 ? CYS A 48 ? PRO A 45 CYS A 48 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 5 A CYS 48 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 12 A CYS 41 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf3 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 57 SG ? ? A CYS 27 A CYS 57 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf4 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 31 A CYS 59 1_555 ? ? ? ? ? ? ? 2.031 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 5 ? CYS A 48 ? CYS A 5 ? 1_555 CYS A 48 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 12 ? CYS A 41 ? CYS A 12 ? 1_555 CYS A 41 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 27 ? CYS A 57 ? CYS A 27 ? 1_555 CYS A 57 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 31 ? CYS A 59 ? CYS A 31 ? 1_555 CYS A 59 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 39 ? GLU A 43 ? GLY A 39 GLU A 43 A 2 TRP A 55 ? CYS A 59 ? TRP A 55 CYS A 59 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLN _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 40 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 40 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 58 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 58 # _pdbx_entry_details.entry_id 2K35 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 OE1 A GLU 42 ? ? HZ3 A LYS 44 ? ? 1.57 2 3 HZ1 A LYS 25 ? ? OD1 A ASP 29 ? ? 1.58 3 5 OD2 A ASP 4 ? ? HH21 A ARG 30 ? ? 1.57 4 10 OE2 A GLU 7 ? ? HZ3 A LYS 53 ? ? 1.59 5 11 HZ2 A LYS 25 ? ? OE2 A GLU 33 ? ? 1.59 6 11 H2 A GLN 1 ? ? OD1 A ASP 4 ? ? 1.60 7 12 HZ1 A LYS 25 ? ? OD2 A ASP 29 ? ? 1.60 8 14 H2 A GLN 1 ? ? OE2 A GLU 33 ? ? 1.56 9 15 OE1 A GLU 42 ? ? HZ2 A LYS 44 ? ? 1.55 10 15 H1 A GLN 1 ? ? OE1 A GLU 33 ? ? 1.57 11 18 HZ3 A LYS 25 ? ? OE2 A GLU 33 ? ? 1.58 12 18 OE1 A GLU 7 ? ? HZ2 A LYS 53 ? ? 1.59 13 18 HZ2 A LYS 25 ? ? OD1 A ASP 29 ? ? 1.59 14 19 H2 A GLN 1 ? ? OD2 A ASP 4 ? ? 1.54 15 19 HZ2 A LYS 25 ? ? OD1 A ASP 29 ? ? 1.59 16 19 OE1 A GLU 42 ? ? HZ2 A LYS 44 ? ? 1.59 17 20 HZ2 A LYS 25 ? ? OE1 A GLU 33 ? ? 1.56 18 20 HZ1 A LYS 25 ? ? OD2 A ASP 29 ? ? 1.57 19 21 HZ2 A LYS 25 ? ? OD2 A ASP 29 ? ? 1.59 20 23 OD1 A ASP 4 ? ? H A CYS 57 ? ? 1.59 21 23 OD2 A ASP 4 ? ? HH12 A ARG 30 ? ? 1.60 22 25 H2 A GLN 1 ? ? OE1 A GLU 33 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 3 ? ? 73.62 92.00 2 1 CYS A 5 ? ? -162.88 116.91 3 1 GLN A 17 ? ? 77.77 132.80 4 1 THR A 20 ? ? 66.35 98.49 5 1 TRP A 24 ? ? -91.35 -65.63 6 1 SER A 26 ? ? 66.16 168.72 7 1 LYS A 53 ? ? -99.87 -61.04 8 2 VAL A 3 ? ? -155.68 27.74 9 2 GLU A 7 ? ? -124.24 -50.77 10 2 SER A 16 ? ? -85.80 -122.41 11 2 LEU A 23 ? ? 172.49 89.41 12 2 TRP A 24 ? ? -68.73 -71.26 13 2 LYS A 25 ? ? 68.98 -86.44 14 2 SER A 26 ? ? 179.28 143.21 15 2 LYS A 37 ? ? -131.76 -42.07 16 2 PRO A 49 ? ? -73.41 42.06 17 2 LYS A 53 ? ? -115.16 -79.55 18 2 ALA A 54 ? ? 68.39 -9.33 19 3 ILE A 2 ? ? -95.64 -147.33 20 3 VAL A 3 ? ? 66.97 88.77 21 3 CYS A 5 ? ? 179.25 130.45 22 3 THR A 20 ? ? 44.83 -120.24 23 3 LYS A 25 ? ? 49.55 -127.32 24 3 LYS A 53 ? ? -88.68 -79.29 25 4 ASP A 4 ? ? -117.56 -157.91 26 4 TRP A 6 ? ? -141.58 -160.00 27 4 GLU A 7 ? ? -118.90 -143.46 28 4 THR A 8 ? ? 47.76 -108.68 29 4 TRP A 9 ? ? -164.60 -64.63 30 4 SER A 16 ? ? -146.28 -154.21 31 4 GLN A 17 ? ? -122.17 -119.44 32 4 THR A 22 ? ? -143.65 -4.24 33 4 LEU A 23 ? ? -95.18 32.81 34 4 LYS A 25 ? ? 57.33 -134.02 35 4 PRO A 45 ? ? -70.76 -148.10 36 4 SER A 46 ? ? 80.56 -8.83 37 4 ARG A 47 ? ? -152.47 13.85 38 4 LYS A 53 ? ? -90.20 43.04 39 4 TRP A 55 ? ? -165.35 103.30 40 5 VAL A 3 ? ? -69.71 88.11 41 5 TRP A 6 ? ? -115.01 -111.68 42 5 GLU A 7 ? ? 175.18 -63.87 43 5 GLN A 17 ? ? 52.80 -101.86 44 5 TRP A 24 ? ? -86.56 -135.98 45 5 SER A 26 ? ? 71.67 151.58 46 5 GLU A 43 ? ? -73.07 -71.38 47 5 ALA A 54 ? ? -51.26 107.22 48 6 VAL A 3 ? ? 71.85 113.74 49 6 ASP A 4 ? ? -174.51 110.54 50 6 CYS A 5 ? ? -163.88 112.78 51 6 TRP A 6 ? ? -166.88 -128.78 52 6 GLU A 7 ? ? -118.25 -134.31 53 6 THR A 8 ? ? -142.15 -2.47 54 6 TRP A 9 ? ? -86.22 45.61 55 6 SER A 10 ? ? 72.24 -8.96 56 6 THR A 22 ? ? -126.84 -54.52 57 6 TRP A 24 ? ? 57.83 78.81 58 6 LYS A 53 ? ? -108.70 -65.99 59 7 ILE A 2 ? ? -91.09 -114.35 60 7 VAL A 3 ? ? 77.31 59.67 61 7 TRP A 15 ? ? 179.25 -153.17 62 7 SER A 16 ? ? -141.69 -137.49 63 7 THR A 20 ? ? 70.48 110.34 64 7 THR A 22 ? ? -95.42 -82.36 65 7 LEU A 23 ? ? -127.70 -100.10 66 7 TRP A 24 ? ? 176.14 -147.11 67 7 LYS A 25 ? ? 65.98 -139.17 68 7 LYS A 37 ? ? -103.08 -62.46 69 7 LYS A 53 ? ? -105.55 -66.61 70 8 VAL A 3 ? ? 71.74 135.88 71 8 ASP A 4 ? ? -171.70 136.03 72 8 GLU A 7 ? ? -130.10 -71.32 73 8 THR A 8 ? ? -102.36 -80.15 74 8 TRP A 9 ? ? -130.33 -77.24 75 8 LYS A 14 ? ? -139.34 -53.64 76 8 TRP A 15 ? ? -66.91 -94.83 77 8 SER A 16 ? ? 176.85 -113.62 78 8 THR A 20 ? ? 61.82 -162.63 79 8 THR A 22 ? ? -152.23 -68.81 80 8 LEU A 23 ? ? -164.62 -42.60 81 8 TRP A 24 ? ? 72.12 111.45 82 8 LYS A 25 ? ? -155.84 -112.96 83 8 PRO A 45 ? ? -78.75 22.63 84 9 ILE A 2 ? ? -100.22 -155.14 85 9 VAL A 3 ? ? 46.38 72.05 86 9 GLU A 7 ? ? -94.57 -71.11 87 9 GLN A 17 ? ? 68.79 170.55 88 9 THR A 20 ? ? 70.13 -23.22 89 9 LEU A 23 ? ? -128.33 -77.95 90 9 TRP A 24 ? ? 66.67 171.24 91 9 LYS A 25 ? ? 73.62 134.43 92 9 PRO A 45 ? ? -72.63 24.08 93 9 LYS A 53 ? ? -101.27 -80.56 94 9 ALA A 54 ? ? 67.26 -26.18 95 10 ASP A 4 ? ? -78.30 26.37 96 10 CYS A 5 ? ? 54.48 -171.86 97 10 TRP A 6 ? ? -167.45 -71.19 98 10 GLU A 7 ? ? 178.45 -65.72 99 10 LYS A 14 ? ? -138.11 -135.64 100 10 TRP A 15 ? ? 44.97 -150.14 101 10 SER A 16 ? ? 162.40 104.00 102 10 SER A 26 ? ? 50.27 -139.72 103 10 CYS A 27 ? ? -136.65 -41.51 104 10 LYS A 37 ? ? -93.57 -73.53 105 10 ARG A 38 ? ? -122.19 -165.87 106 10 ALA A 54 ? ? -63.78 78.34 107 11 VAL A 3 ? ? 59.99 15.89 108 11 GLU A 7 ? ? -179.63 -88.39 109 11 THR A 8 ? ? -134.12 -64.32 110 11 TRP A 9 ? ? -86.65 42.30 111 11 TRP A 15 ? ? -102.14 -159.56 112 11 SER A 16 ? ? -150.00 27.25 113 11 GLN A 17 ? ? 176.46 171.51 114 11 THR A 20 ? ? -126.72 -60.75 115 11 LEU A 23 ? ? -162.49 80.54 116 11 TRP A 24 ? ? -108.80 -71.90 117 11 SER A 26 ? ? 70.82 139.78 118 11 LYS A 53 ? ? -144.09 41.44 119 12 VAL A 3 ? ? 77.27 98.55 120 12 GLU A 7 ? ? 171.99 -41.24 121 12 THR A 13 ? ? -136.95 -58.73 122 12 LYS A 14 ? ? -103.28 -90.08 123 12 TRP A 15 ? ? -69.30 92.38 124 12 GLN A 17 ? ? 172.34 166.42 125 12 THR A 20 ? ? 52.02 -156.35 126 12 THR A 22 ? ? -171.15 -40.56 127 12 LYS A 25 ? ? 54.28 -95.75 128 12 LYS A 37 ? ? -92.74 -60.68 129 12 CYS A 41 ? ? -67.17 98.77 130 12 PRO A 45 ? ? -75.70 29.09 131 13 VAL A 3 ? ? 71.67 143.56 132 13 GLU A 7 ? ? -137.08 -60.37 133 13 THR A 8 ? ? -129.96 -76.25 134 13 TRP A 9 ? ? -143.74 -68.85 135 13 ARG A 11 ? ? -78.29 42.04 136 13 CYS A 12 ? ? -149.17 -39.86 137 13 SER A 16 ? ? -84.58 -114.47 138 13 GLN A 17 ? ? -92.18 -106.55 139 13 THR A 22 ? ? -137.30 -51.83 140 13 LEU A 23 ? ? -160.35 75.95 141 13 LYS A 25 ? ? 68.68 -71.39 142 13 SER A 26 ? ? -176.30 142.52 143 13 GLU A 42 ? ? -122.82 -157.76 144 13 GLU A 43 ? ? -94.32 -140.75 145 13 LYS A 44 ? ? 63.36 70.37 146 13 PRO A 45 ? ? -55.97 101.58 147 13 ARG A 47 ? ? -166.34 50.23 148 13 LYS A 53 ? ? -89.89 -86.75 149 13 ALA A 54 ? ? 71.56 -39.42 150 14 VAL A 3 ? ? 67.40 90.00 151 14 ASP A 4 ? ? -105.78 -168.78 152 14 GLU A 7 ? ? -152.02 -66.40 153 14 LYS A 14 ? ? -140.85 42.17 154 14 TRP A 15 ? ? -150.02 -152.44 155 14 SER A 16 ? ? -148.60 -124.19 156 14 THR A 22 ? ? -68.83 -72.88 157 14 LEU A 23 ? ? -151.24 -96.26 158 14 TRP A 24 ? ? -176.75 -116.32 159 14 LYS A 25 ? ? 65.11 -121.91 160 14 CYS A 41 ? ? -68.66 99.30 161 14 LYS A 52 ? ? -165.89 -48.29 162 14 ALA A 54 ? ? 72.51 -49.52 163 15 ILE A 2 ? ? -90.94 -146.78 164 15 VAL A 3 ? ? 74.81 94.93 165 15 TRP A 6 ? ? -152.20 -89.96 166 15 GLU A 7 ? ? -153.54 -77.41 167 15 LYS A 14 ? ? -82.98 -74.60 168 15 TRP A 15 ? ? -142.20 -155.47 169 15 SER A 16 ? ? -156.29 -134.14 170 15 THR A 20 ? ? 73.15 112.69 171 15 TRP A 24 ? ? 49.06 -120.08 172 15 LYS A 25 ? ? 66.25 166.90 173 15 LYS A 44 ? ? 30.15 72.74 174 15 LYS A 53 ? ? -108.89 -62.35 175 15 ALA A 54 ? ? 60.50 82.57 176 16 VAL A 3 ? ? 60.58 88.20 177 16 GLU A 7 ? ? -90.13 -83.40 178 16 SER A 16 ? ? -160.03 115.75 179 16 THR A 20 ? ? 68.72 -61.50 180 16 LYS A 25 ? ? 67.68 -89.79 181 16 SER A 26 ? ? 171.32 138.09 182 16 GLU A 43 ? ? -47.24 -73.10 183 16 LYS A 44 ? ? 36.67 85.67 184 16 ARG A 47 ? ? -149.17 24.96 185 16 SER A 51 ? ? 73.09 173.18 186 16 LYS A 52 ? ? -95.71 33.99 187 16 ALA A 54 ? ? 70.36 -54.21 188 17 VAL A 3 ? ? 74.12 139.92 189 17 CYS A 5 ? ? -171.66 122.41 190 17 TRP A 15 ? ? -103.90 -120.02 191 17 SER A 16 ? ? -157.54 -113.59 192 17 GLN A 17 ? ? -101.55 -164.30 193 17 THR A 20 ? ? 74.53 -44.43 194 17 LEU A 23 ? ? 74.15 65.33 195 17 LYS A 37 ? ? -107.16 -75.64 196 18 VAL A 3 ? ? 76.48 96.23 197 18 GLU A 7 ? ? -132.53 -63.51 198 18 THR A 8 ? ? -87.93 -74.13 199 18 TRP A 9 ? ? -154.56 -64.39 200 18 THR A 13 ? ? -134.26 -55.27 201 18 TRP A 15 ? ? -101.39 -154.57 202 18 SER A 16 ? ? -133.79 -129.44 203 18 THR A 20 ? ? 71.01 -64.64 204 18 LEU A 23 ? ? 63.61 81.80 205 18 TRP A 24 ? ? -58.07 -79.18 206 18 LYS A 25 ? ? 62.75 -0.86 207 18 SER A 26 ? ? 72.56 136.81 208 18 LYS A 37 ? ? -99.18 -63.01 209 18 ALA A 54 ? ? 68.91 -34.19 210 19 VAL A 3 ? ? 48.21 28.52 211 19 TRP A 6 ? ? -173.13 -167.60 212 19 TRP A 15 ? ? 73.64 -63.33 213 19 SER A 16 ? ? 74.04 -46.12 214 19 GLN A 17 ? ? 79.99 -16.29 215 19 LYS A 25 ? ? 66.14 -95.33 216 19 SER A 26 ? ? -170.25 144.77 217 19 LYS A 37 ? ? -91.99 -69.22 218 19 LYS A 52 ? ? -94.69 38.93 219 19 LYS A 53 ? ? -135.35 -66.66 220 19 ALA A 54 ? ? 73.89 -44.95 221 20 ASP A 4 ? ? -173.94 129.67 222 20 GLU A 7 ? ? -131.37 -119.59 223 20 GLN A 17 ? ? 54.47 -132.50 224 20 THR A 20 ? ? 78.01 -28.85 225 20 THR A 22 ? ? -141.72 37.46 226 20 LYS A 25 ? ? 57.08 -104.14 227 20 GLU A 43 ? ? -94.21 -96.91 228 20 LYS A 44 ? ? 42.23 71.74 229 20 PRO A 45 ? ? -73.95 38.52 230 20 ARG A 47 ? ? -141.71 48.36 231 20 LYS A 52 ? ? -84.17 30.59 232 20 LYS A 53 ? ? -141.07 -80.70 233 20 ALA A 54 ? ? 74.10 -37.07 234 21 ILE A 2 ? ? -102.45 -94.71 235 21 GLU A 7 ? ? -119.39 -119.80 236 21 LYS A 14 ? ? -119.91 60.03 237 21 TRP A 15 ? ? -158.73 32.53 238 21 GLN A 17 ? ? 71.93 -1.58 239 21 LEU A 23 ? ? -105.22 58.21 240 21 GLU A 42 ? ? -119.50 -165.91 241 21 GLU A 43 ? ? -74.26 -87.09 242 21 PRO A 45 ? ? -79.66 47.52 243 21 SER A 51 ? ? 64.21 -178.17 244 21 ALA A 54 ? ? 70.80 -44.30 245 22 ILE A 2 ? ? 70.55 141.16 246 22 VAL A 3 ? ? 65.20 77.61 247 22 LYS A 14 ? ? -147.72 34.44 248 22 TRP A 15 ? ? -134.05 -147.26 249 22 SER A 16 ? ? -173.13 135.50 250 22 THR A 20 ? ? 64.24 -96.54 251 22 THR A 22 ? ? -163.81 -43.05 252 22 LEU A 23 ? ? -84.58 42.18 253 22 LYS A 25 ? ? 46.15 -115.46 254 22 LYS A 53 ? ? -122.07 -72.97 255 22 ALA A 54 ? ? 68.89 -25.68 256 23 VAL A 3 ? ? 73.90 128.03 257 23 ASP A 4 ? ? -176.61 148.71 258 23 TRP A 9 ? ? -159.59 -67.75 259 23 CYS A 12 ? ? -162.70 -57.06 260 23 LYS A 14 ? ? -108.74 -61.30 261 23 SER A 16 ? ? -110.93 -93.17 262 23 THR A 20 ? ? 72.97 -53.19 263 23 THR A 22 ? ? -101.55 -80.42 264 23 LEU A 23 ? ? 179.34 80.50 265 23 LYS A 25 ? ? 71.30 -29.25 266 23 SER A 26 ? ? 75.35 146.98 267 23 ARG A 36 ? ? -105.34 -142.85 268 23 LYS A 37 ? ? -158.80 -56.55 269 23 CYS A 41 ? ? -69.98 91.01 270 23 PRO A 45 ? ? -76.82 41.74 271 23 LYS A 53 ? ? -93.54 -67.12 272 23 ALA A 54 ? ? 66.12 -42.64 273 23 CYS A 57 ? ? -67.67 89.56 274 24 ILE A 2 ? ? -91.08 -137.67 275 24 VAL A 3 ? ? 69.22 70.55 276 24 TRP A 6 ? ? -151.17 -150.39 277 24 GLU A 7 ? ? -90.58 -120.63 278 24 TRP A 9 ? ? 59.11 74.24 279 24 SER A 10 ? ? 73.54 -33.88 280 24 SER A 16 ? ? -173.95 145.01 281 24 GLN A 17 ? ? 74.32 66.94 282 24 THR A 20 ? ? 65.50 82.11 283 24 LYS A 25 ? ? -74.67 43.51 284 24 SER A 26 ? ? 65.35 117.32 285 24 ARG A 47 ? ? -115.62 -77.33 286 24 PRO A 49 ? ? -78.97 27.55 287 24 LYS A 53 ? ? -111.66 -71.52 288 25 VAL A 3 ? ? 70.64 109.93 289 25 ASP A 4 ? ? -85.56 -146.28 290 25 CYS A 5 ? ? 179.14 132.62 291 25 GLU A 7 ? ? -134.16 -66.97 292 25 THR A 8 ? ? -126.56 -76.18 293 25 TRP A 9 ? ? -138.90 -78.91 294 25 ARG A 11 ? ? -77.76 43.50 295 25 CYS A 12 ? ? -143.45 -43.32 296 25 SER A 16 ? ? -161.25 111.59 297 25 GLN A 17 ? ? 73.07 158.98 298 25 TRP A 24 ? ? 59.75 -106.61 299 25 LYS A 25 ? ? 65.73 107.82 300 25 GLU A 43 ? ? -61.14 -80.82 301 25 LYS A 44 ? ? 44.21 82.66 302 25 ARG A 47 ? ? -132.38 -49.19 303 25 LYS A 53 ? ? -108.17 -70.27 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K35 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K35 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.contents '1.0 mM [U-100% 13C; U-100% 15N] hydramacin-1, 93% H2O/7% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' # _pdbx_nmr_exptl_sample.component hydramacin-1 _pdbx_nmr_exptl_sample.concentration 1.0 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.050 _pdbx_nmr_exptl_sample_conditions.pH 5.7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCA' 1 2 1 '3D HNCO' 1 3 1 '3D H(CCO)NH' 1 4 1 '3D C(CO)NH' 1 5 1 '3D HCACO' 1 6 1 '3D CBCA(CO)NH' 1 7 1 '3D HNCACB' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-15N TOCSY' 1 10 1 '3D 1H-13C NOESY' 1 11 1 '3D HCCH-TOCSY' # _pdbx_nmr_refine.entry_id 2K35 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'HADDOCK SOFTWARE INCLUDING A WATER SHELL IS ALSO USED FOR REFINEMENT' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 1 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 PRO N N N N 206 PRO CA C N S 207 PRO C C N N 208 PRO O O N N 209 PRO CB C N N 210 PRO CG C N N 211 PRO CD C N N 212 PRO OXT O N N 213 PRO H H N N 214 PRO HA H N N 215 PRO HB2 H N N 216 PRO HB3 H N N 217 PRO HG2 H N N 218 PRO HG3 H N N 219 PRO HD2 H N N 220 PRO HD3 H N N 221 PRO HXT H N N 222 SER N N N N 223 SER CA C N S 224 SER C C N N 225 SER O O N N 226 SER CB C N N 227 SER OG O N N 228 SER OXT O N N 229 SER H H N N 230 SER H2 H N N 231 SER HA H N N 232 SER HB2 H N N 233 SER HB3 H N N 234 SER HG H N N 235 SER HXT H N N 236 THR N N N N 237 THR CA C N S 238 THR C C N N 239 THR O O N N 240 THR CB C N R 241 THR OG1 O N N 242 THR CG2 C N N 243 THR OXT O N N 244 THR H H N N 245 THR H2 H N N 246 THR HA H N N 247 THR HB H N N 248 THR HG1 H N N 249 THR HG21 H N N 250 THR HG22 H N N 251 THR HG23 H N N 252 THR HXT H N N 253 TRP N N N N 254 TRP CA C N S 255 TRP C C N N 256 TRP O O N N 257 TRP CB C N N 258 TRP CG C Y N 259 TRP CD1 C Y N 260 TRP CD2 C Y N 261 TRP NE1 N Y N 262 TRP CE2 C Y N 263 TRP CE3 C Y N 264 TRP CZ2 C Y N 265 TRP CZ3 C Y N 266 TRP CH2 C Y N 267 TRP OXT O N N 268 TRP H H N N 269 TRP H2 H N N 270 TRP HA H N N 271 TRP HB2 H N N 272 TRP HB3 H N N 273 TRP HD1 H N N 274 TRP HE1 H N N 275 TRP HE3 H N N 276 TRP HZ2 H N N 277 TRP HZ3 H N N 278 TRP HH2 H N N 279 TRP HXT H N N 280 TYR N N N N 281 TYR CA C N S 282 TYR C C N N 283 TYR O O N N 284 TYR CB C N N 285 TYR CG C Y N 286 TYR CD1 C Y N 287 TYR CD2 C Y N 288 TYR CE1 C Y N 289 TYR CE2 C Y N 290 TYR CZ C Y N 291 TYR OH O N N 292 TYR OXT O N N 293 TYR H H N N 294 TYR H2 H N N 295 TYR HA H N N 296 TYR HB2 H N N 297 TYR HB3 H N N 298 TYR HD1 H N N 299 TYR HD2 H N N 300 TYR HE1 H N N 301 TYR HE2 H N N 302 TYR HH H N N 303 TYR HXT H N N 304 VAL N N N N 305 VAL CA C N S 306 VAL C C N N 307 VAL O O N N 308 VAL CB C N N 309 VAL CG1 C N N 310 VAL CG2 C N N 311 VAL OXT O N N 312 VAL H H N N 313 VAL H2 H N N 314 VAL HA H N N 315 VAL HB H N N 316 VAL HG11 H N N 317 VAL HG12 H N N 318 VAL HG13 H N N 319 VAL HG21 H N N 320 VAL HG22 H N N 321 VAL HG23 H N N 322 VAL HXT H N N 323 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 PRO N CA sing N N 195 PRO N CD sing N N 196 PRO N H sing N N 197 PRO CA C sing N N 198 PRO CA CB sing N N 199 PRO CA HA sing N N 200 PRO C O doub N N 201 PRO C OXT sing N N 202 PRO CB CG sing N N 203 PRO CB HB2 sing N N 204 PRO CB HB3 sing N N 205 PRO CG CD sing N N 206 PRO CG HG2 sing N N 207 PRO CG HG3 sing N N 208 PRO CD HD2 sing N N 209 PRO CD HD3 sing N N 210 PRO OXT HXT sing N N 211 SER N CA sing N N 212 SER N H sing N N 213 SER N H2 sing N N 214 SER CA C sing N N 215 SER CA CB sing N N 216 SER CA HA sing N N 217 SER C O doub N N 218 SER C OXT sing N N 219 SER CB OG sing N N 220 SER CB HB2 sing N N 221 SER CB HB3 sing N N 222 SER OG HG sing N N 223 SER OXT HXT sing N N 224 THR N CA sing N N 225 THR N H sing N N 226 THR N H2 sing N N 227 THR CA C sing N N 228 THR CA CB sing N N 229 THR CA HA sing N N 230 THR C O doub N N 231 THR C OXT sing N N 232 THR CB OG1 sing N N 233 THR CB CG2 sing N N 234 THR CB HB sing N N 235 THR OG1 HG1 sing N N 236 THR CG2 HG21 sing N N 237 THR CG2 HG22 sing N N 238 THR CG2 HG23 sing N N 239 THR OXT HXT sing N N 240 TRP N CA sing N N 241 TRP N H sing N N 242 TRP N H2 sing N N 243 TRP CA C sing N N 244 TRP CA CB sing N N 245 TRP CA HA sing N N 246 TRP C O doub N N 247 TRP C OXT sing N N 248 TRP CB CG sing N N 249 TRP CB HB2 sing N N 250 TRP CB HB3 sing N N 251 TRP CG CD1 doub Y N 252 TRP CG CD2 sing Y N 253 TRP CD1 NE1 sing Y N 254 TRP CD1 HD1 sing N N 255 TRP CD2 CE2 doub Y N 256 TRP CD2 CE3 sing Y N 257 TRP NE1 CE2 sing Y N 258 TRP NE1 HE1 sing N N 259 TRP CE2 CZ2 sing Y N 260 TRP CE3 CZ3 doub Y N 261 TRP CE3 HE3 sing N N 262 TRP CZ2 CH2 doub Y N 263 TRP CZ2 HZ2 sing N N 264 TRP CZ3 CH2 sing Y N 265 TRP CZ3 HZ3 sing N N 266 TRP CH2 HH2 sing N N 267 TRP OXT HXT sing N N 268 TYR N CA sing N N 269 TYR N H sing N N 270 TYR N H2 sing N N 271 TYR CA C sing N N 272 TYR CA CB sing N N 273 TYR CA HA sing N N 274 TYR C O doub N N 275 TYR C OXT sing N N 276 TYR CB CG sing N N 277 TYR CB HB2 sing N N 278 TYR CB HB3 sing N N 279 TYR CG CD1 doub Y N 280 TYR CG CD2 sing Y N 281 TYR CD1 CE1 sing Y N 282 TYR CD1 HD1 sing N N 283 TYR CD2 CE2 doub Y N 284 TYR CD2 HD2 sing N N 285 TYR CE1 CZ doub Y N 286 TYR CE1 HE1 sing N N 287 TYR CE2 CZ sing Y N 288 TYR CE2 HE2 sing N N 289 TYR CZ OH sing N N 290 TYR OH HH sing N N 291 TYR OXT HXT sing N N 292 VAL N CA sing N N 293 VAL N H sing N N 294 VAL N H2 sing N N 295 VAL CA C sing N N 296 VAL CA CB sing N N 297 VAL CA HA sing N N 298 VAL C O doub N N 299 VAL C OXT sing N N 300 VAL CB CG1 sing N N 301 VAL CB CG2 sing N N 302 VAL CB HB sing N N 303 VAL CG1 HG11 sing N N 304 VAL CG1 HG12 sing N N 305 VAL CG1 HG13 sing N N 306 VAL CG2 HG21 sing N N 307 VAL CG2 HG22 sing N N 308 VAL CG2 HG23 sing N N 309 VAL OXT HXT sing N N 310 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _atom_sites.entry_id 2K35 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #