data_2K37 # _entry.id 2K37 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K37 pdb_00002k37 10.2210/pdb2k37/pdb RCSB RCSB100618 ? ? BMRB 15742 ? ? WWPDB D_1000100618 ? ? # _pdbx_database_related.db_id 15742 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K37 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-04-23 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pedersen, M.' 1 'Dittmer, J.' 2 'Underhaug, J.' 3 'Miller, M.' 4 'Nielsen, N.C.' 5 # _citation.id primary _citation.title 'The three-dimensional structure of CsmA: A small antenna protein from the green sulfur bacterium Chlorobium tepidum.' _citation.journal_abbrev 'Febs Lett.' _citation.journal_volume 582 _citation.page_first 2869 _citation.page_last 2874 _citation.year 2008 _citation.journal_id_ASTM FEBLAL _citation.country NE _citation.journal_id_ISSN 0014-5793 _citation.journal_id_CSD 0165 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18652828 _citation.pdbx_database_id_DOI 10.1016/j.febslet.2008.07.020 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pedersen, M.O.' 1 ? primary 'Underhaug, J.' 2 ? primary 'Dittmer, J.' 3 ? primary 'Miller, M.' 4 ? primary 'Nielsen, N.C.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Chlorosome Protein A' _entity.formula_weight 6160.034 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 1-59' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BACTERIOCHLOROPHYLL C-BINDING PROTEIN, BChl c-binding' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MSGGGVFTDILAAAGRIFEVMVEGHWETVGMLFDSLGKGTMRINRNAYGSMGGGSLRGS _entity_poly.pdbx_seq_one_letter_code_can MSGGGVFTDILAAAGRIFEVMVEGHWETVGMLFDSLGKGTMRINRNAYGSMGGGSLRGS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLY n 1 4 GLY n 1 5 GLY n 1 6 VAL n 1 7 PHE n 1 8 THR n 1 9 ASP n 1 10 ILE n 1 11 LEU n 1 12 ALA n 1 13 ALA n 1 14 ALA n 1 15 GLY n 1 16 ARG n 1 17 ILE n 1 18 PHE n 1 19 GLU n 1 20 VAL n 1 21 MET n 1 22 VAL n 1 23 GLU n 1 24 GLY n 1 25 HIS n 1 26 TRP n 1 27 GLU n 1 28 THR n 1 29 VAL n 1 30 GLY n 1 31 MET n 1 32 LEU n 1 33 PHE n 1 34 ASP n 1 35 SER n 1 36 LEU n 1 37 GLY n 1 38 LYS n 1 39 GLY n 1 40 THR n 1 41 MET n 1 42 ARG n 1 43 ILE n 1 44 ASN n 1 45 ARG n 1 46 ASN n 1 47 ALA n 1 48 TYR n 1 49 GLY n 1 50 SER n 1 51 MET n 1 52 GLY n 1 53 GLY n 1 54 GLY n 1 55 SER n 1 56 LEU n 1 57 ARG n 1 58 GLY n 1 59 SER n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Chlorobium tepidum' _entity_src_nat.pdbx_ncbi_taxonomy_id ? _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CSMA_CHLTE _struct_ref.pdbx_db_accession P0A314 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MSGGGVFTDILAAAGRIFEVMVEGHWETVGMLFDSLGKGTMRINRNAYGSMGGGSLRGS _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K37 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 59 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A314 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 59 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 59 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D 1H-1H COSY' 1 4 1 '2D 1H-1H NOESY' 1 5 1 '3D HNHA' 1 6 1 '3D NOESY-HSQC' 1 7 1 '3D TOCSY-HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH ? _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.4 mM [U-100% 15N] CsmA, 50% chloroform/50% methanol' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '50% chloroform/50% methanol' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 700 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2K37 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details CNS _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 9 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K37 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K37 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Goddard processing Sparky ? 1 Bruker collection TopSpin ? 2 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 2.2 3 ;Linge, O'Donoghue and Nilges ; refinement ARIA 2.2 4 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Solution NMR structure of CsmA purified from 15-N labeled Chlorobium tepidum cells' _exptl.entry_id 2K37 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K37 _struct.title CsmA _struct.pdbx_model_details 'Solution NMR structure of CsmA purified from 15-N labeled Chlorobium tepidum cells' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K37 _struct_keywords.pdbx_keywords PHOTOSYNTHESIS _struct_keywords.text ;PROTEIN, Bacteriochlorophyll, Chlorophyll, Chlorosome, Chromophore, Electron transport, Magnesium, Metal-binding, Photosynthesis, Transport ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 4 ? PHE A 33 ? GLY A 4 PHE A 33 1 ? 30 HELX_P HELX_P2 2 GLY A 39 ? ALA A 47 ? GLY A 39 ALA A 47 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2K37 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 SER 59 59 59 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-09-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.component CsmA _pdbx_nmr_exptl_sample.concentration 1.4 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2K37 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1426 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 490 _pdbx_nmr_constraints.NOE_long_range_total_count 0 _pdbx_nmr_constraints.NOE_medium_range_total_count 526 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 338 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 31 ? ? -104.89 -68.13 2 1 LEU A 36 ? ? -148.15 34.51 3 1 SER A 50 ? ? -166.70 -31.68 4 1 ARG A 57 ? ? 47.30 23.29 5 2 SER A 2 ? ? -168.22 110.79 6 2 VAL A 6 ? ? -170.99 -30.39 7 2 MET A 31 ? ? -102.27 -69.65 8 2 LEU A 36 ? ? -148.74 29.24 9 2 LYS A 38 ? ? -154.80 -43.45 10 2 THR A 40 ? ? -169.83 35.62 11 2 SER A 50 ? ? -165.23 -36.71 12 2 SER A 55 ? ? -75.72 21.21 13 3 VAL A 6 ? ? -172.00 -38.98 14 3 MET A 31 ? ? -105.50 -68.09 15 3 THR A 40 ? ? -172.16 74.39 16 3 SER A 50 ? ? -163.06 -38.16 17 3 SER A 55 ? ? 39.03 44.09 18 3 LEU A 56 ? ? 68.18 -22.42 19 4 VAL A 6 ? ? -163.51 -53.12 20 4 MET A 31 ? ? -102.02 -67.62 21 4 LEU A 36 ? ? -141.35 38.09 22 4 SER A 50 ? ? -165.36 -34.17 23 5 VAL A 6 ? ? -162.50 -44.66 24 5 MET A 31 ? ? -107.91 -67.23 25 5 LEU A 36 ? ? -160.04 33.00 26 5 LYS A 38 ? ? -165.05 -40.55 27 5 THR A 40 ? ? -170.59 26.35 28 5 SER A 50 ? ? -165.33 -38.28 29 5 LEU A 56 ? ? -77.74 21.07 30 6 VAL A 6 ? ? 78.12 -6.16 31 6 LEU A 36 ? ? -155.95 44.27 32 6 SER A 50 ? ? -166.55 -31.04 33 6 SER A 55 ? ? -75.22 24.94 34 6 ARG A 57 ? ? 36.98 40.12 35 7 SER A 2 ? ? 58.80 17.44 36 7 LEU A 36 ? ? -141.80 39.35 37 7 SER A 50 ? ? -166.13 -34.03 38 7 ARG A 57 ? ? -86.38 31.46 39 8 SER A 2 ? ? -146.42 16.76 40 8 MET A 31 ? ? -101.19 -68.18 41 8 SER A 50 ? ? -163.50 -39.81 42 8 LEU A 56 ? ? 37.34 29.43 43 9 MET A 31 ? ? -103.89 -65.08 44 9 THR A 40 ? ? 39.14 35.24 45 9 SER A 50 ? ? -163.40 -35.49 46 9 SER A 55 ? ? 55.36 11.90 #