data_2K3H # _entry.id 2K3H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K3H pdb_00002k3h 10.2210/pdb2k3h/pdb RCSB RCSB100628 ? ? WWPDB D_1000100628 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-10-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_conn_angle 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_site 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.value' 17 3 'Structure model' '_struct_conn.pdbx_dist_value' 18 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 25 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 28 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 29 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 30 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K3H _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-05-08 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 6787 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Coudevylle, N.' 1 'Montaville, P.' 2 'Leonov, A.' 3 'Zweckstetter, M.' 4 'Becker, S.' 5 # _citation.id primary _citation.title 'Structural Determinants for Ca2+ and Phosphatidylinositol 4,5-Bisphosphate Binding by the C2A Domain of Rabphilin-3A.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 283 _citation.page_first 35918 _citation.page_last 35928 _citation.year 2008 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18945677 _citation.pdbx_database_id_DOI 10.1074/jbc.M804094200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Coudevylle, N.' 1 ? primary 'Montaville, P.' 2 ? primary 'Leonov, A.' 3 ? primary 'Zweckstetter, M.' 4 ? primary 'Becker, S.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Rabphilin-3A 16073.175 1 ? ? 'C2A domain (UNP residues 368-570)' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'C2 domain' 2 'CALCIUM (II) ION' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EANSYDSDEATTLGALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWN ETLQYHGITEEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKANQRKNFNICLERVI ; _entity_poly.pdbx_seq_one_letter_code_can ;EANSYDSDEATTLGALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWN ETLQYHGITEEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKANQRKNFNICLERVI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ALA n 1 3 ASN n 1 4 SER n 1 5 TYR n 1 6 ASP n 1 7 SER n 1 8 ASP n 1 9 GLU n 1 10 ALA n 1 11 THR n 1 12 THR n 1 13 LEU n 1 14 GLY n 1 15 ALA n 1 16 LEU n 1 17 GLU n 1 18 PHE n 1 19 SER n 1 20 LEU n 1 21 LEU n 1 22 TYR n 1 23 ASP n 1 24 GLN n 1 25 ASP n 1 26 ASN n 1 27 SER n 1 28 ASN n 1 29 LEU n 1 30 GLN n 1 31 CYS n 1 32 THR n 1 33 ILE n 1 34 ILE n 1 35 ARG n 1 36 ALA n 1 37 LYS n 1 38 GLY n 1 39 LEU n 1 40 LYS n 1 41 PRO n 1 42 MET n 1 43 ASP n 1 44 SER n 1 45 ASN n 1 46 GLY n 1 47 LEU n 1 48 ALA n 1 49 ASP n 1 50 PRO n 1 51 TYR n 1 52 VAL n 1 53 LYS n 1 54 LEU n 1 55 HIS n 1 56 LEU n 1 57 LEU n 1 58 PRO n 1 59 GLY n 1 60 ALA n 1 61 SER n 1 62 LYS n 1 63 SER n 1 64 ASN n 1 65 LYS n 1 66 LEU n 1 67 ARG n 1 68 THR n 1 69 LYS n 1 70 THR n 1 71 LEU n 1 72 ARG n 1 73 ASN n 1 74 THR n 1 75 ARG n 1 76 ASN n 1 77 PRO n 1 78 VAL n 1 79 TRP n 1 80 ASN n 1 81 GLU n 1 82 THR n 1 83 LEU n 1 84 GLN n 1 85 TYR n 1 86 HIS n 1 87 GLY n 1 88 ILE n 1 89 THR n 1 90 GLU n 1 91 GLU n 1 92 ASP n 1 93 MET n 1 94 GLN n 1 95 ARG n 1 96 LYS n 1 97 THR n 1 98 LEU n 1 99 ARG n 1 100 ILE n 1 101 SER n 1 102 VAL n 1 103 CYS n 1 104 ASP n 1 105 GLU n 1 106 ASP n 1 107 LYS n 1 108 PHE n 1 109 GLY n 1 110 HIS n 1 111 ASN n 1 112 GLU n 1 113 PHE n 1 114 ILE n 1 115 GLY n 1 116 GLU n 1 117 THR n 1 118 ARG n 1 119 PHE n 1 120 SER n 1 121 LEU n 1 122 LYS n 1 123 LYS n 1 124 LEU n 1 125 LYS n 1 126 ALA n 1 127 ASN n 1 128 GLN n 1 129 ARG n 1 130 LYS n 1 131 ASN n 1 132 PHE n 1 133 ASN n 1 134 ILE n 1 135 CYS n 1 136 LEU n 1 137 GLU n 1 138 ARG n 1 139 VAL n 1 140 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Rph3a _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector pGEX2T _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 371 ? ? ? A . n A 1 2 ALA 2 372 ? ? ? A . n A 1 3 ASN 3 373 ? ? ? A . n A 1 4 SER 4 374 ? ? ? A . n A 1 5 TYR 5 375 ? ? ? A . n A 1 6 ASP 6 376 ? ? ? A . n A 1 7 SER 7 377 ? ? ? A . n A 1 8 ASP 8 378 ? ? ? A . n A 1 9 GLU 9 379 ? ? ? A . n A 1 10 ALA 10 380 ? ? ? A . n A 1 11 THR 11 381 ? ? ? A . n A 1 12 THR 12 382 ? ? ? A . n A 1 13 LEU 13 383 ? ? ? A . n A 1 14 GLY 14 384 384 GLY GLY A . n A 1 15 ALA 15 385 385 ALA ALA A . n A 1 16 LEU 16 386 386 LEU LEU A . n A 1 17 GLU 17 387 387 GLU GLU A . n A 1 18 PHE 18 388 388 PHE PHE A . n A 1 19 SER 19 389 389 SER SER A . n A 1 20 LEU 20 390 390 LEU LEU A . n A 1 21 LEU 21 391 391 LEU LEU A . n A 1 22 TYR 22 392 392 TYR TYR A . n A 1 23 ASP 23 393 393 ASP ASP A . n A 1 24 GLN 24 394 394 GLN GLN A . n A 1 25 ASP 25 395 395 ASP ASP A . n A 1 26 ASN 26 396 396 ASN ASN A . n A 1 27 SER 27 397 397 SER SER A . n A 1 28 ASN 28 398 398 ASN ASN A . n A 1 29 LEU 29 399 399 LEU LEU A . n A 1 30 GLN 30 400 400 GLN GLN A . n A 1 31 CYS 31 401 401 CYS CYS A . n A 1 32 THR 32 402 402 THR THR A . n A 1 33 ILE 33 403 403 ILE ILE A . n A 1 34 ILE 34 404 404 ILE ILE A . n A 1 35 ARG 35 405 405 ARG ARG A . n A 1 36 ALA 36 406 406 ALA ALA A . n A 1 37 LYS 37 407 407 LYS LYS A . n A 1 38 GLY 38 408 408 GLY GLY A . n A 1 39 LEU 39 409 409 LEU LEU A . n A 1 40 LYS 40 410 410 LYS LYS A . n A 1 41 PRO 41 411 411 PRO PRO A . n A 1 42 MET 42 412 412 MET MET A . n A 1 43 ASP 43 413 413 ASP ASP A . n A 1 44 SER 44 414 414 SER SER A . n A 1 45 ASN 45 415 415 ASN ASN A . n A 1 46 GLY 46 416 416 GLY GLY A . n A 1 47 LEU 47 417 417 LEU LEU A . n A 1 48 ALA 48 418 418 ALA ALA A . n A 1 49 ASP 49 419 419 ASP ASP A . n A 1 50 PRO 50 420 420 PRO PRO A . n A 1 51 TYR 51 421 421 TYR TYR A . n A 1 52 VAL 52 422 422 VAL VAL A . n A 1 53 LYS 53 423 423 LYS LYS A . n A 1 54 LEU 54 424 424 LEU LEU A . n A 1 55 HIS 55 425 425 HIS HIS A . n A 1 56 LEU 56 426 426 LEU LEU A . n A 1 57 LEU 57 427 427 LEU LEU A . n A 1 58 PRO 58 428 428 PRO PRO A . n A 1 59 GLY 59 429 429 GLY GLY A . n A 1 60 ALA 60 430 430 ALA ALA A . n A 1 61 SER 61 431 431 SER SER A . n A 1 62 LYS 62 432 432 LYS LYS A . n A 1 63 SER 63 433 433 SER SER A . n A 1 64 ASN 64 434 434 ASN ASN A . n A 1 65 LYS 65 435 435 LYS LYS A . n A 1 66 LEU 66 436 436 LEU LEU A . n A 1 67 ARG 67 437 437 ARG ARG A . n A 1 68 THR 68 438 438 THR THR A . n A 1 69 LYS 69 439 439 LYS LYS A . n A 1 70 THR 70 440 440 THR THR A . n A 1 71 LEU 71 441 441 LEU LEU A . n A 1 72 ARG 72 442 442 ARG ARG A . n A 1 73 ASN 73 443 443 ASN ASN A . n A 1 74 THR 74 444 444 THR THR A . n A 1 75 ARG 75 445 445 ARG ARG A . n A 1 76 ASN 76 446 446 ASN ASN A . n A 1 77 PRO 77 447 447 PRO PRO A . n A 1 78 VAL 78 448 448 VAL VAL A . n A 1 79 TRP 79 449 449 TRP TRP A . n A 1 80 ASN 80 450 450 ASN ASN A . n A 1 81 GLU 81 451 451 GLU GLU A . n A 1 82 THR 82 452 452 THR THR A . n A 1 83 LEU 83 453 453 LEU LEU A . n A 1 84 GLN 84 454 454 GLN GLN A . n A 1 85 TYR 85 455 455 TYR TYR A . n A 1 86 HIS 86 456 456 HIS HIS A . n A 1 87 GLY 87 457 457 GLY GLY A . n A 1 88 ILE 88 458 458 ILE ILE A . n A 1 89 THR 89 459 459 THR THR A . n A 1 90 GLU 90 460 460 GLU GLU A . n A 1 91 GLU 91 461 461 GLU GLU A . n A 1 92 ASP 92 462 462 ASP ASP A . n A 1 93 MET 93 463 463 MET MET A . n A 1 94 GLN 94 464 464 GLN GLN A . n A 1 95 ARG 95 465 465 ARG ARG A . n A 1 96 LYS 96 466 466 LYS LYS A . n A 1 97 THR 97 467 467 THR THR A . n A 1 98 LEU 98 468 468 LEU LEU A . n A 1 99 ARG 99 469 469 ARG ARG A . n A 1 100 ILE 100 470 470 ILE ILE A . n A 1 101 SER 101 471 471 SER SER A . n A 1 102 VAL 102 472 472 VAL VAL A . n A 1 103 CYS 103 473 473 CYS CYS A . n A 1 104 ASP 104 474 474 ASP ASP A . n A 1 105 GLU 105 475 475 GLU GLU A . n A 1 106 ASP 106 476 476 ASP ASP A . n A 1 107 LYS 107 477 477 LYS LYS A . n A 1 108 PHE 108 478 478 PHE PHE A . n A 1 109 GLY 109 479 479 GLY GLY A . n A 1 110 HIS 110 480 480 HIS HIS A . n A 1 111 ASN 111 481 481 ASN ASN A . n A 1 112 GLU 112 482 482 GLU GLU A . n A 1 113 PHE 113 483 483 PHE PHE A . n A 1 114 ILE 114 484 484 ILE ILE A . n A 1 115 GLY 115 485 485 GLY GLY A . n A 1 116 GLU 116 486 486 GLU GLU A . n A 1 117 THR 117 487 487 THR THR A . n A 1 118 ARG 118 488 488 ARG ARG A . n A 1 119 PHE 119 489 489 PHE PHE A . n A 1 120 SER 120 490 490 SER SER A . n A 1 121 LEU 121 491 491 LEU LEU A . n A 1 122 LYS 122 492 492 LYS LYS A . n A 1 123 LYS 123 493 493 LYS LYS A . n A 1 124 LEU 124 494 494 LEU LEU A . n A 1 125 LYS 125 495 495 LYS LYS A . n A 1 126 ALA 126 496 496 ALA ALA A . n A 1 127 ASN 127 497 497 ASN ASN A . n A 1 128 GLN 128 498 498 GLN GLN A . n A 1 129 ARG 129 499 499 ARG ARG A . n A 1 130 LYS 130 500 500 LYS LYS A . n A 1 131 ASN 131 501 501 ASN ASN A . n A 1 132 PHE 132 502 502 PHE PHE A . n A 1 133 ASN 133 503 503 ASN ASN A . n A 1 134 ILE 134 504 504 ILE ILE A . n A 1 135 CYS 135 505 505 CYS CYS A . n A 1 136 LEU 136 506 506 LEU LEU A . n A 1 137 GLU 137 507 507 GLU GLU A . n A 1 138 ARG 138 508 508 ARG ARG A . n A 1 139 VAL 139 509 509 VAL VAL A . n A 1 140 ILE 140 510 510 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 1 1 CA CA A . C 2 CA 1 2 2 CA CA A . # _cell.entry_id 2K3H _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2K3H _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Ca2+ bound form of the C2A domain of Rabphilin-3A' _exptl.entry_id 2K3H _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K3H _struct.title 'Structural determinants for Ca2+ and PIP2 binding by the C2A domain of rabphilin-3A' _struct.pdbx_model_details 'Ca2+ bound form of the C2A domain of Rabphilin-3A' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K3H _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' _struct_keywords.text ;PIP2, C2 domain, Calcium, TAMA mechanism, Cell junction, Metal-binding, Phosphoprotein, Protein transport, Synapse, Transport, Zinc, Zinc-finger ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RP3A_MOUSE _struct_ref.pdbx_db_accession P47708 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EANSYDSDEATTLGALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWN ETLQYHGITEEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKANQRKNFNICLERVI ; _struct_ref.pdbx_align_begin 368 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K3H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 140 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P47708 _struct_ref_seq.db_align_beg 368 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 507 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 371 _struct_ref_seq.pdbx_auth_seq_align_end 510 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 89 ? GLN A 94 ? THR A 459 GLN A 464 1 ? 6 HELX_P HELX_P2 2 LYS A 122 ? LEU A 124 ? LYS A 492 LEU A 494 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 43 OD1 ? ? A CA 1 A ASP 413 1_555 ? ? ? ? ? ? ? 2.801 ? ? metalc2 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 43 OD2 ? ? A CA 1 A ASP 413 1_555 ? ? ? ? ? ? ? 2.802 ? ? metalc3 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 49 N ? ? A CA 1 A ASP 419 1_555 ? ? ? ? ? ? ? 2.906 ? ? metalc4 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 49 OD1 ? ? A CA 1 A ASP 419 1_555 ? ? ? ? ? ? ? 2.802 ? ? metalc5 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 104 OD1 ? ? A CA 1 A ASP 474 1_555 ? ? ? ? ? ? ? 2.804 ? ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 A GLU 105 O ? ? A CA 1 A GLU 475 1_555 ? ? ? ? ? ? ? 2.803 ? ? metalc7 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 106 OD1 ? ? A CA 1 A ASP 476 1_555 ? ? ? ? ? ? ? 2.405 ? ? metalc8 metalc ? ? C CA . CA ? ? ? 1_555 A MET 42 O ? ? A CA 2 A MET 412 1_555 ? ? ? ? ? ? ? 2.763 ? ? metalc9 metalc ? ? C CA . CA ? ? ? 1_555 A ASP 43 OD1 ? ? A CA 2 A ASP 413 1_555 ? ? ? ? ? ? ? 2.800 ? ? metalc10 metalc ? ? C CA . CA ? ? ? 1_555 A ASP 104 OD2 ? ? A CA 2 A ASP 474 1_555 ? ? ? ? ? ? ? 2.798 ? ? metalc11 metalc ? ? C CA . CA ? ? ? 1_555 A ASP 106 OD1 ? ? A CA 2 A ASP 476 1_555 ? ? ? ? ? ? ? 2.801 ? ? metalc12 metalc ? ? C CA . CA ? ? ? 1_555 A ASP 106 OD2 ? ? A CA 2 A ASP 476 1_555 ? ? ? ? ? ? ? 2.553 ? ? metalc13 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 112 OE1 ? ? A CA 2 A GLU 482 1_555 ? ? ? ? ? ? ? 2.801 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 43 ? A ASP 413 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 OD2 ? A ASP 43 ? A ASP 413 ? 1_555 45.2 ? 2 OD1 ? A ASP 43 ? A ASP 413 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 N ? A ASP 49 ? A ASP 419 ? 1_555 148.4 ? 3 OD2 ? A ASP 43 ? A ASP 413 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 N ? A ASP 49 ? A ASP 419 ? 1_555 111.9 ? 4 OD1 ? A ASP 43 ? A ASP 413 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 OD1 ? A ASP 49 ? A ASP 419 ? 1_555 123.8 ? 5 OD2 ? A ASP 43 ? A ASP 413 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 OD1 ? A ASP 49 ? A ASP 419 ? 1_555 83.5 ? 6 N ? A ASP 49 ? A ASP 419 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 OD1 ? A ASP 49 ? A ASP 419 ? 1_555 58.5 ? 7 OD1 ? A ASP 43 ? A ASP 413 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 OD1 ? A ASP 104 ? A ASP 474 ? 1_555 119.1 ? 8 OD2 ? A ASP 43 ? A ASP 413 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 OD1 ? A ASP 104 ? A ASP 474 ? 1_555 146.8 ? 9 N ? A ASP 49 ? A ASP 419 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 OD1 ? A ASP 104 ? A ASP 474 ? 1_555 65.8 ? 10 OD1 ? A ASP 49 ? A ASP 419 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 OD1 ? A ASP 104 ? A ASP 474 ? 1_555 116.8 ? 11 OD1 ? A ASP 43 ? A ASP 413 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O ? A GLU 105 ? A GLU 475 ? 1_555 122.5 ? 12 OD2 ? A ASP 43 ? A ASP 413 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O ? A GLU 105 ? A GLU 475 ? 1_555 131.8 ? 13 N ? A ASP 49 ? A ASP 419 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O ? A GLU 105 ? A GLU 475 ? 1_555 88.9 ? 14 OD1 ? A ASP 49 ? A ASP 419 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O ? A GLU 105 ? A GLU 475 ? 1_555 70.8 ? 15 OD1 ? A ASP 104 ? A ASP 474 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O ? A GLU 105 ? A GLU 475 ? 1_555 81.1 ? 16 OD1 ? A ASP 43 ? A ASP 413 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 OD1 ? A ASP 106 ? A ASP 476 ? 1_555 53.5 ? 17 OD2 ? A ASP 43 ? A ASP 413 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 OD1 ? A ASP 106 ? A ASP 476 ? 1_555 93.2 ? 18 N ? A ASP 49 ? A ASP 419 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 OD1 ? A ASP 106 ? A ASP 476 ? 1_555 154.9 ? 19 OD1 ? A ASP 49 ? A ASP 419 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 OD1 ? A ASP 106 ? A ASP 476 ? 1_555 128.0 ? 20 OD1 ? A ASP 104 ? A ASP 474 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 OD1 ? A ASP 106 ? A ASP 476 ? 1_555 93.3 ? 21 O ? A GLU 105 ? A GLU 475 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 OD1 ? A ASP 106 ? A ASP 476 ? 1_555 73.6 ? 22 O ? A MET 42 ? A MET 412 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 OD1 ? A ASP 43 ? A ASP 413 ? 1_555 87.7 ? 23 O ? A MET 42 ? A MET 412 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 OD2 ? A ASP 104 ? A ASP 474 ? 1_555 124.3 ? 24 OD1 ? A ASP 43 ? A ASP 413 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 OD2 ? A ASP 104 ? A ASP 474 ? 1_555 84.2 ? 25 O ? A MET 42 ? A MET 412 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 OD1 ? A ASP 106 ? A ASP 476 ? 1_555 137.7 ? 26 OD1 ? A ASP 43 ? A ASP 413 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 OD1 ? A ASP 106 ? A ASP 476 ? 1_555 50.1 ? 27 OD2 ? A ASP 104 ? A ASP 474 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 OD1 ? A ASP 106 ? A ASP 476 ? 1_555 57.9 ? 28 O ? A MET 42 ? A MET 412 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 OD2 ? A ASP 106 ? A ASP 476 ? 1_555 143.8 ? 29 OD1 ? A ASP 43 ? A ASP 413 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 OD2 ? A ASP 106 ? A ASP 476 ? 1_555 82.9 ? 30 OD2 ? A ASP 104 ? A ASP 474 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 OD2 ? A ASP 106 ? A ASP 476 ? 1_555 89.5 ? 31 OD1 ? A ASP 106 ? A ASP 476 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 OD2 ? A ASP 106 ? A ASP 476 ? 1_555 47.2 ? 32 O ? A MET 42 ? A MET 412 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 OE1 ? A GLU 112 ? A GLU 482 ? 1_555 61.7 ? 33 OD1 ? A ASP 43 ? A ASP 413 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 OE1 ? A GLU 112 ? A GLU 482 ? 1_555 148.9 ? 34 OD2 ? A ASP 104 ? A ASP 474 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 OE1 ? A GLU 112 ? A GLU 482 ? 1_555 116.8 ? 35 OD1 ? A ASP 106 ? A ASP 476 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 OE1 ? A GLU 112 ? A GLU 482 ? 1_555 160.5 ? 36 OD2 ? A ASP 106 ? A ASP 476 ? 1_555 CA ? C CA . ? A CA 2 ? 1_555 OE1 ? A GLU 112 ? A GLU 482 ? 1_555 117.8 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 1 -0.99 2 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 2 -0.99 3 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 3 -1.04 4 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 4 -1.06 5 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 5 -1.05 6 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 6 -1.18 7 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 7 -1.32 8 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 8 -0.94 9 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 9 -0.75 10 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 10 -1.09 11 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 11 -0.96 12 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 12 -1.11 13 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 13 -0.85 14 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 14 -1.00 15 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 15 -1.04 16 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 16 -0.53 17 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 17 -0.55 18 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 18 -1.45 19 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 19 -0.85 20 LEU 57 A . ? LEU 427 A PRO 58 A ? PRO 428 A 20 -0.88 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 78 ? HIS A 86 ? VAL A 448 HIS A 456 A 2 ASN A 28 ? LYS A 37 ? ASN A 398 LYS A 407 A 3 ALA A 15 ? ASP A 23 ? ALA A 385 ASP A 393 A 4 GLN A 128 ? CYS A 135 ? GLN A 498 CYS A 505 B 1 LYS A 65 ? THR A 70 ? LYS A 435 THR A 440 B 2 PRO A 50 ? LEU A 57 ? PRO A 420 LEU A 427 B 3 THR A 97 ? GLU A 105 ? THR A 467 GLU A 475 B 4 ASN A 111 ? SER A 120 ? ASN A 481 SER A 490 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 83 ? O LEU A 453 N CYS A 31 ? N CYS A 401 A 2 3 O THR A 32 ? O THR A 402 N SER A 19 ? N SER A 389 A 3 4 N PHE A 18 ? N PHE A 388 O PHE A 132 ? O PHE A 502 B 1 2 O THR A 68 ? O THR A 438 N VAL A 52 ? N VAL A 422 B 2 3 N LYS A 53 ? N LYS A 423 O SER A 101 ? O SER A 471 B 3 4 N VAL A 102 ? N VAL A 472 O GLY A 115 ? O GLY A 485 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 1 ? 5 'BINDING SITE FOR RESIDUE CA A 1' AC2 Software A CA 2 ? 4 'BINDING SITE FOR RESIDUE CA A 2' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 MET A 42 ? MET A 412 . ? 1_555 ? 2 AC1 5 ASP A 43 ? ASP A 413 . ? 1_555 ? 3 AC1 5 ALA A 48 ? ALA A 418 . ? 1_555 ? 4 AC1 5 ASP A 49 ? ASP A 419 . ? 1_555 ? 5 AC1 5 ASP A 106 ? ASP A 476 . ? 1_555 ? 6 AC2 4 PRO A 41 ? PRO A 411 . ? 1_555 ? 7 AC2 4 MET A 42 ? MET A 412 . ? 1_555 ? 8 AC2 4 ASP A 104 ? ASP A 474 . ? 1_555 ? 9 AC2 4 ASP A 106 ? ASP A 476 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A SER 389 ? ? O A THR 402 ? ? 1.46 2 1 O A LYS 477 ? ? H A GLY 479 ? ? 1.47 3 1 O A SER 389 ? ? H A THR 402 ? ? 1.49 4 1 O A ASP 413 ? ? H A GLY 416 ? ? 1.53 5 1 O A LEU 491 ? ? H A LEU 494 ? ? 1.55 6 1 OE1 A GLU 387 ? ? HE A ARG 405 ? ? 1.56 7 2 H A SER 389 ? ? O A THR 402 ? ? 1.43 8 2 O A SER 389 ? ? H A THR 402 ? ? 1.44 9 2 O A LYS 477 ? ? H A GLY 479 ? ? 1.47 10 2 O A ASP 413 ? ? H A GLY 416 ? ? 1.52 11 3 H A SER 389 ? ? O A THR 402 ? ? 1.41 12 3 O A SER 389 ? ? H A THR 402 ? ? 1.43 13 3 O A VAL 422 ? ? HG1 A THR 438 ? ? 1.45 14 3 O A LYS 477 ? ? H A GLY 479 ? ? 1.48 15 3 O A ASP 413 ? ? H A GLY 416 ? ? 1.49 16 4 H A SER 389 ? ? O A THR 402 ? ? 1.43 17 4 O A SER 389 ? ? H A THR 402 ? ? 1.45 18 4 O A LYS 477 ? ? H A GLY 479 ? ? 1.48 19 4 O A ASP 413 ? ? H A GLY 416 ? ? 1.49 20 4 O A LEU 491 ? ? H A LEU 494 ? ? 1.54 21 4 O A ASP 462 ? ? H A LYS 466 ? ? 1.56 22 5 H A SER 389 ? ? O A THR 402 ? ? 1.43 23 5 O A SER 389 ? ? H A THR 402 ? ? 1.45 24 5 O A LYS 477 ? ? H A GLY 479 ? ? 1.47 25 5 O A ASP 413 ? ? H A GLY 416 ? ? 1.54 26 5 O A SER 389 ? ? HG1 A THR 402 ? ? 1.54 27 5 O A LEU 491 ? ? H A LEU 494 ? ? 1.55 28 5 O A GLN 464 ? ? HZ3 A LYS 492 ? ? 1.59 29 6 H A SER 389 ? ? O A THR 402 ? ? 1.42 30 6 O A SER 389 ? ? H A THR 402 ? ? 1.45 31 6 O A ASP 413 ? ? H A GLY 416 ? ? 1.51 32 6 O A SER 389 ? ? HG1 A THR 402 ? ? 1.55 33 7 H A SER 389 ? ? O A THR 402 ? ? 1.43 34 7 O A SER 389 ? ? H A THR 402 ? ? 1.45 35 7 O A ASP 413 ? ? H A GLY 416 ? ? 1.49 36 7 O A LYS 477 ? ? H A GLY 479 ? ? 1.49 37 7 O A ASP 462 ? ? H A LYS 466 ? ? 1.54 38 7 O A LEU 491 ? ? H A LEU 494 ? ? 1.56 39 8 H A SER 389 ? ? O A THR 402 ? ? 1.44 40 8 O A LYS 477 ? ? H A GLY 479 ? ? 1.46 41 8 O A SER 389 ? ? H A THR 402 ? ? 1.48 42 8 O A SER 389 ? ? HG1 A THR 402 ? ? 1.51 43 8 O A LEU 491 ? ? H A LEU 494 ? ? 1.53 44 8 O A ASP 413 ? ? H A GLY 416 ? ? 1.54 45 9 O A SER 389 ? ? H A THR 402 ? ? 1.45 46 9 H A SER 389 ? ? O A THR 402 ? ? 1.47 47 9 O A LYS 477 ? ? H A GLY 479 ? ? 1.47 48 9 O A ASP 413 ? ? H A GLY 416 ? ? 1.53 49 9 O A ALA 430 ? ? HD21 A ASN 434 ? ? 1.57 50 9 O A LEU 491 ? ? H A LEU 494 ? ? 1.59 51 10 O A SER 389 ? ? H A THR 402 ? ? 1.44 52 10 H A SER 389 ? ? O A THR 402 ? ? 1.46 53 10 HE21 A GLN 394 ? ? OD1 A ASN 497 ? ? 1.46 54 10 O A LYS 477 ? ? H A GLY 479 ? ? 1.48 55 10 O A ASP 413 ? ? H A GLY 416 ? ? 1.50 56 10 O A LEU 491 ? ? H A LEU 494 ? ? 1.57 57 11 O A SER 389 ? ? H A THR 402 ? ? 1.43 58 11 H A SER 389 ? ? O A THR 402 ? ? 1.43 59 11 O A ASP 413 ? ? H A GLY 416 ? ? 1.52 60 11 O A SER 389 ? ? HG1 A THR 402 ? ? 1.54 61 12 H A SER 389 ? ? O A THR 402 ? ? 1.42 62 12 O A SER 389 ? ? H A THR 402 ? ? 1.46 63 12 O A LYS 477 ? ? H A GLY 479 ? ? 1.48 64 12 OG A SER 490 ? ? HZ1 A LYS 492 ? ? 1.49 65 12 O A ASP 413 ? ? H A GLY 416 ? ? 1.54 66 13 H A SER 389 ? ? O A THR 402 ? ? 1.44 67 13 O A SER 389 ? ? H A THR 402 ? ? 1.45 68 13 O A ASP 413 ? ? H A GLY 416 ? ? 1.53 69 13 O A LEU 491 ? ? H A LEU 494 ? ? 1.55 70 13 O A ASP 462 ? ? H A LYS 466 ? ? 1.59 71 14 O A SER 389 ? ? H A THR 402 ? ? 1.44 72 14 H A SER 389 ? ? O A THR 402 ? ? 1.44 73 14 O A LYS 477 ? ? H A GLY 479 ? ? 1.47 74 14 O A ASP 413 ? ? H A GLY 416 ? ? 1.48 75 14 O A PRO 428 ? ? HZ1 A LYS 466 ? ? 1.52 76 15 H A SER 389 ? ? O A THR 402 ? ? 1.43 77 15 O A LYS 477 ? ? H A GLY 479 ? ? 1.46 78 15 O A SER 389 ? ? H A THR 402 ? ? 1.48 79 15 O A ASP 413 ? ? H A GLY 416 ? ? 1.49 80 15 O A PRO 428 ? ? HZ1 A LYS 466 ? ? 1.50 81 16 O A SER 389 ? ? H A THR 402 ? ? 1.45 82 16 H A SER 389 ? ? O A THR 402 ? ? 1.48 83 16 O A PRO 428 ? ? HZ3 A LYS 466 ? ? 1.49 84 16 O A LEU 491 ? ? H A LEU 494 ? ? 1.52 85 16 O A ASP 413 ? ? H A GLY 416 ? ? 1.53 86 17 H A SER 389 ? ? O A THR 402 ? ? 1.44 87 17 O A SER 389 ? ? H A THR 402 ? ? 1.44 88 17 O A LYS 477 ? ? H A GLY 479 ? ? 1.47 89 17 O A SER 433 ? ? HH A TYR 455 ? ? 1.52 90 17 O A LEU 491 ? ? H A LEU 494 ? ? 1.53 91 17 O A ASP 413 ? ? H A GLY 416 ? ? 1.54 92 18 HD1 A HIS 425 ? ? HH21 A ARG 469 ? ? 1.27 93 18 H A SER 389 ? ? O A THR 402 ? ? 1.42 94 18 O A SER 389 ? ? H A THR 402 ? ? 1.44 95 18 O A LYS 477 ? ? H A GLY 479 ? ? 1.46 96 18 O A ASP 413 ? ? H A GLY 416 ? ? 1.51 97 19 H A SER 389 ? ? O A THR 402 ? ? 1.41 98 19 O A SER 389 ? ? H A THR 402 ? ? 1.48 99 19 O A ASP 413 ? ? H A GLY 416 ? ? 1.51 100 19 O A LEU 491 ? ? H A LEU 494 ? ? 1.54 101 20 H A SER 389 ? ? O A THR 402 ? ? 1.46 102 20 O A LYS 477 ? ? H A GLY 479 ? ? 1.47 103 20 O A SER 389 ? ? H A THR 402 ? ? 1.48 104 20 O A ASP 413 ? ? H A GLY 416 ? ? 1.49 105 20 O A LEU 491 ? ? H A LEU 494 ? ? 1.52 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 404 ? ? -77.07 -71.25 2 1 PRO A 411 ? ? -30.05 143.82 3 1 MET A 412 ? ? -128.76 -68.33 4 1 ALA A 418 ? ? -171.42 143.76 5 1 SER A 431 ? ? -53.43 -4.73 6 1 SER A 433 ? ? -155.57 19.28 7 1 ASN A 434 ? ? -73.53 25.31 8 1 ASN A 443 ? ? 35.31 80.16 9 1 ARG A 445 ? ? -147.17 -11.22 10 1 ASN A 446 ? ? -155.60 60.61 11 1 ASP A 476 ? ? -119.98 -134.89 12 1 PHE A 478 ? ? -65.45 51.44 13 2 ILE A 404 ? ? -77.85 -71.65 14 2 PRO A 411 ? ? -32.29 149.11 15 2 MET A 412 ? ? -128.63 -67.04 16 2 ALA A 418 ? ? -170.32 142.48 17 2 SER A 431 ? ? -50.92 -7.32 18 2 SER A 433 ? ? -156.82 18.61 19 2 ASN A 434 ? ? -73.35 24.36 20 2 ASN A 443 ? ? 36.07 80.36 21 2 ARG A 445 ? ? -148.96 -12.90 22 2 ASN A 446 ? ? -153.52 71.10 23 2 ARG A 465 ? ? -146.51 -34.12 24 2 ASP A 476 ? ? -122.71 -133.52 25 2 PHE A 478 ? ? -65.36 52.06 26 2 ILE A 484 ? ? -84.59 -70.07 27 2 ARG A 508 ? ? -160.67 115.67 28 2 VAL A 509 ? ? -172.61 126.41 29 3 ILE A 404 ? ? -78.72 -71.89 30 3 PRO A 411 ? ? -26.04 136.28 31 3 MET A 412 ? ? -117.83 -75.52 32 3 SER A 414 ? ? -49.65 -19.01 33 3 LEU A 417 ? ? -113.76 -169.70 34 3 SER A 431 ? ? -56.52 -0.41 35 3 SER A 433 ? ? -158.57 22.27 36 3 ASN A 434 ? ? -72.56 30.77 37 3 ASN A 443 ? ? 37.83 81.23 38 3 ARG A 445 ? ? -149.50 -10.33 39 3 ASN A 446 ? ? -156.45 69.30 40 3 GLN A 464 ? ? -96.47 33.67 41 3 ARG A 465 ? ? -154.38 -32.29 42 3 ASP A 476 ? ? -128.11 -134.08 43 3 PHE A 478 ? ? -65.97 51.56 44 3 VAL A 509 ? ? -172.57 125.83 45 4 ILE A 404 ? ? -79.62 -71.97 46 4 PRO A 411 ? ? -26.05 136.56 47 4 MET A 412 ? ? -118.54 -76.05 48 4 LEU A 417 ? ? -110.15 -169.17 49 4 SER A 431 ? ? -51.56 -7.40 50 4 SER A 433 ? ? -155.38 19.32 51 4 ASN A 434 ? ? -73.60 25.33 52 4 ASN A 443 ? ? 38.77 81.56 53 4 ARG A 445 ? ? -150.11 -10.24 54 4 ASN A 446 ? ? -157.08 68.99 55 4 ARG A 465 ? ? -146.92 -29.66 56 4 ASP A 476 ? ? -127.25 -132.97 57 4 PHE A 478 ? ? -65.94 51.58 58 4 VAL A 509 ? ? -172.60 127.12 59 5 ILE A 404 ? ? -78.65 -72.15 60 5 PRO A 411 ? ? -30.16 144.69 61 5 MET A 412 ? ? -128.27 -67.84 62 5 ALA A 418 ? ? -172.18 143.59 63 5 SER A 431 ? ? -51.02 -8.16 64 5 SER A 433 ? ? -156.03 19.61 65 5 ASN A 434 ? ? -73.36 24.43 66 5 ASN A 443 ? ? 35.82 80.46 67 5 ARG A 445 ? ? -145.93 -10.74 68 5 ASN A 446 ? ? -156.68 61.55 69 5 ASP A 476 ? ? -121.44 -136.20 70 5 PHE A 478 ? ? -65.17 51.88 71 6 ILE A 404 ? ? -78.71 -71.60 72 6 PRO A 411 ? ? -32.44 149.66 73 6 MET A 412 ? ? -128.60 -68.06 74 6 SER A 431 ? ? -57.53 1.20 75 6 SER A 433 ? ? -157.59 21.79 76 6 ASN A 434 ? ? -73.14 24.80 77 6 ASN A 443 ? ? 35.55 80.09 78 6 ARG A 445 ? ? -149.22 -12.97 79 6 ASN A 446 ? ? -153.44 71.03 80 6 ASP A 476 ? ? -119.82 -126.13 81 6 PHE A 478 ? ? -68.52 21.25 82 6 ILE A 484 ? ? -88.12 -70.10 83 6 ARG A 508 ? ? -172.12 127.77 84 7 ILE A 404 ? ? -79.72 -72.07 85 7 PRO A 411 ? ? -26.86 138.14 86 7 MET A 412 ? ? -118.38 -76.56 87 7 SER A 414 ? ? -49.63 -19.20 88 7 LEU A 417 ? ? -111.42 -168.99 89 7 SER A 431 ? ? -56.39 -0.03 90 7 SER A 433 ? ? -155.69 18.80 91 7 ASN A 434 ? ? -73.01 22.35 92 7 ASN A 443 ? ? 39.53 81.59 93 7 ARG A 445 ? ? -151.06 -8.79 94 7 ASN A 446 ? ? -157.13 69.09 95 7 ASP A 476 ? ? -126.26 -132.71 96 7 PHE A 478 ? ? -66.15 52.06 97 7 ARG A 508 ? ? -57.14 175.86 98 7 VAL A 509 ? ? -162.36 118.99 99 8 ILE A 404 ? ? -77.87 -71.66 100 8 PRO A 411 ? ? -29.72 144.26 101 8 MET A 412 ? ? -128.20 -67.72 102 8 ALA A 418 ? ? -172.00 145.83 103 8 SER A 431 ? ? -53.18 -4.19 104 8 SER A 433 ? ? -160.71 32.63 105 8 ASN A 443 ? ? 35.39 80.26 106 8 ARG A 445 ? ? -145.24 -10.78 107 8 ASN A 446 ? ? -157.25 61.87 108 8 ASP A 476 ? ? -125.97 -165.38 109 8 LYS A 477 ? ? -56.60 -176.16 110 8 PHE A 478 ? ? -64.56 49.10 111 8 ASN A 497 ? ? 37.86 36.96 112 8 ARG A 508 ? ? -160.05 73.92 113 8 VAL A 509 ? ? -172.59 127.51 114 9 ILE A 404 ? ? -82.28 -72.25 115 9 PRO A 411 ? ? -31.45 147.73 116 9 MET A 412 ? ? -128.30 -69.64 117 9 ALA A 418 ? ? -171.90 141.80 118 9 SER A 431 ? ? -58.60 2.41 119 9 SER A 433 ? ? -156.88 17.75 120 9 ASN A 434 ? ? -72.35 20.30 121 9 ASN A 443 ? ? 40.46 81.82 122 9 ARG A 445 ? ? -150.11 -12.51 123 9 ARG A 465 ? ? -151.76 -33.32 124 9 ASP A 476 ? ? -124.30 -136.42 125 9 PHE A 478 ? ? -65.44 51.24 126 9 VAL A 509 ? ? -172.61 127.24 127 10 ILE A 404 ? ? -87.19 -72.66 128 10 LEU A 409 ? ? -58.21 179.06 129 10 PRO A 411 ? ? -26.14 128.99 130 10 MET A 412 ? ? -109.78 -84.71 131 10 SER A 414 ? ? -49.78 -16.96 132 10 SER A 431 ? ? -57.82 1.19 133 10 SER A 433 ? ? -155.72 18.89 134 10 ASN A 434 ? ? -72.59 22.57 135 10 ASN A 443 ? ? 41.08 81.94 136 10 ARG A 445 ? ? -148.58 -15.96 137 10 ARG A 465 ? ? -148.70 -30.74 138 10 ASP A 476 ? ? -130.30 -141.56 139 10 PHE A 478 ? ? -64.89 43.03 140 10 VAL A 509 ? ? -167.21 76.80 141 11 ILE A 404 ? ? -78.82 -71.75 142 11 PRO A 411 ? ? -32.47 149.06 143 11 MET A 412 ? ? -128.72 -67.58 144 11 ALA A 418 ? ? -170.68 142.28 145 11 SER A 431 ? ? -57.78 0.41 146 11 SER A 433 ? ? -156.10 19.21 147 11 ASN A 434 ? ? -72.14 20.78 148 11 ASN A 443 ? ? 36.02 80.32 149 11 ARG A 445 ? ? -150.11 -12.87 150 11 ASN A 446 ? ? -153.07 70.49 151 11 ARG A 465 ? ? -151.69 -31.19 152 11 ASP A 476 ? ? -119.95 -127.41 153 11 PHE A 478 ? ? -67.88 21.19 154 12 ILE A 404 ? ? -83.09 -72.36 155 12 PRO A 411 ? ? -30.74 145.33 156 12 MET A 412 ? ? -128.42 -68.24 157 12 ALA A 418 ? ? -172.08 144.00 158 12 SER A 431 ? ? -56.57 -0.46 159 12 SER A 433 ? ? -155.95 19.58 160 12 ASN A 434 ? ? -72.84 22.01 161 12 ASN A 443 ? ? 36.12 80.52 162 12 ARG A 445 ? ? -148.74 -9.88 163 12 ASN A 446 ? ? -156.83 62.17 164 12 ASP A 476 ? ? -124.47 -135.00 165 12 PHE A 478 ? ? -65.81 52.11 166 12 ASN A 497 ? ? 39.35 34.01 167 12 VAL A 509 ? ? -172.42 126.11 168 13 ILE A 404 ? ? -81.62 -72.22 169 13 PRO A 411 ? ? -31.41 148.00 170 13 MET A 412 ? ? -128.78 -68.44 171 13 ALA A 418 ? ? -172.05 142.08 172 13 SER A 431 ? ? -50.74 -7.92 173 13 SER A 433 ? ? -149.66 10.41 174 13 ASN A 434 ? ? -72.25 21.12 175 13 ASN A 443 ? ? 40.07 81.66 176 13 ARG A 445 ? ? -149.92 -11.34 177 13 ASP A 476 ? ? -127.32 -129.16 178 13 PHE A 478 ? ? -68.47 19.52 179 13 VAL A 509 ? ? -172.60 126.31 180 14 ILE A 404 ? ? -90.97 -72.52 181 14 PRO A 411 ? ? -34.37 120.79 182 14 MET A 412 ? ? -107.65 -87.35 183 14 SER A 431 ? ? -52.77 -3.25 184 14 SER A 433 ? ? -156.64 19.98 185 14 ASN A 434 ? ? -72.47 20.07 186 14 ASN A 443 ? ? 39.82 81.96 187 14 ARG A 445 ? ? -147.50 -15.24 188 14 ARG A 465 ? ? -147.11 -34.29 189 14 ASP A 476 ? ? -119.78 -139.25 190 14 PHE A 478 ? ? -65.67 51.42 191 14 ILE A 484 ? ? -92.00 -61.79 192 14 ASN A 497 ? ? 41.16 25.05 193 14 VAL A 509 ? ? -160.95 76.65 194 15 ILE A 404 ? ? -81.38 -72.32 195 15 PRO A 411 ? ? -25.09 134.62 196 15 MET A 412 ? ? -113.93 -79.39 197 15 ALA A 418 ? ? -174.18 149.84 198 15 SER A 431 ? ? -52.29 -5.21 199 15 SER A 433 ? ? -150.37 10.51 200 15 ASN A 434 ? ? -71.64 20.10 201 15 ASN A 443 ? ? 41.48 82.15 202 15 ARG A 445 ? ? -150.53 -10.35 203 15 ARG A 465 ? ? -146.51 -32.41 204 15 ASP A 476 ? ? -119.91 -136.07 205 15 PHE A 478 ? ? -64.86 51.68 206 15 ARG A 508 ? ? -161.58 116.22 207 15 VAL A 509 ? ? -164.76 75.99 208 16 ILE A 404 ? ? -82.86 -72.35 209 16 PRO A 411 ? ? -30.77 146.30 210 16 MET A 412 ? ? -128.41 -69.91 211 16 ALA A 418 ? ? -172.15 141.93 212 16 SER A 431 ? ? -54.18 -1.57 213 16 ASN A 443 ? ? 39.89 81.68 214 16 ARG A 445 ? ? -149.31 -11.98 215 16 ARG A 465 ? ? -148.08 -32.02 216 16 ASP A 476 ? ? -126.65 -130.88 217 16 PHE A 478 ? ? -63.40 24.77 218 16 ILE A 484 ? ? -90.66 -70.05 219 16 VAL A 509 ? ? -172.56 127.39 220 17 ILE A 404 ? ? -81.24 -72.45 221 17 PRO A 411 ? ? -28.67 142.94 222 17 MET A 412 ? ? -129.00 -67.15 223 17 ALA A 418 ? ? -171.20 143.68 224 17 SER A 431 ? ? -51.61 -7.38 225 17 ASN A 443 ? ? 34.89 79.86 226 17 ARG A 445 ? ? -148.25 -12.06 227 17 ASN A 446 ? ? -153.73 58.34 228 17 ARG A 465 ? ? -152.81 -28.43 229 17 ASP A 476 ? ? -124.99 -133.56 230 17 PHE A 478 ? ? -65.42 51.82 231 17 ILE A 484 ? ? -82.36 -70.18 232 17 ASN A 497 ? ? 43.39 29.96 233 17 ARG A 508 ? ? -56.33 175.07 234 18 ILE A 404 ? ? -80.41 -72.70 235 18 PRO A 411 ? ? -30.07 147.79 236 18 MET A 412 ? ? -128.83 -66.22 237 18 PRO A 428 ? ? -79.17 42.92 238 18 SER A 433 ? ? -162.69 49.09 239 18 ASN A 443 ? ? 36.28 80.52 240 18 ARG A 445 ? ? -147.07 -14.85 241 18 ASN A 446 ? ? -152.83 71.09 242 18 ARG A 465 ? ? -150.79 -30.49 243 18 ASP A 476 ? ? -123.42 -134.09 244 18 PHE A 478 ? ? -65.22 51.70 245 18 ARG A 508 ? ? -160.21 96.58 246 19 ILE A 404 ? ? -79.42 -72.19 247 19 PRO A 411 ? ? -31.27 146.72 248 19 MET A 412 ? ? -128.36 -67.94 249 19 ALA A 418 ? ? -170.48 141.98 250 19 SER A 431 ? ? -44.00 -15.62 251 19 SER A 433 ? ? -153.95 25.91 252 19 ASN A 443 ? ? 35.69 80.32 253 19 ARG A 445 ? ? -148.65 -12.82 254 19 ASN A 446 ? ? -153.53 70.65 255 19 GLN A 464 ? ? -94.51 30.25 256 19 ARG A 465 ? ? -155.71 -29.88 257 19 ASP A 476 ? ? -119.84 -124.98 258 19 PHE A 478 ? ? -68.66 21.78 259 19 ILE A 484 ? ? -91.16 -69.21 260 20 ILE A 404 ? ? -84.33 -73.06 261 20 PRO A 411 ? ? -27.39 141.81 262 20 MET A 412 ? ? -119.50 -74.85 263 20 SER A 414 ? ? -49.81 -17.11 264 20 LEU A 417 ? ? -116.49 -169.04 265 20 SER A 431 ? ? -55.68 -1.54 266 20 SER A 433 ? ? -155.26 20.69 267 20 ASN A 443 ? ? 38.49 81.76 268 20 ARG A 445 ? ? -147.05 -2.72 269 20 ASN A 446 ? ? -165.11 62.27 270 20 ASP A 476 ? ? -120.03 -137.85 271 20 PHE A 478 ? ? -65.36 51.48 272 20 ARG A 508 ? ? -172.32 98.53 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K3H _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K3H _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.contents '1 mM [U-13C; U-15N] C2A domain, 20 mM Na acetate, 150 mM NaCl, 20 mM CaCl2, 1 mM DTT, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'C2A domain' 1 mM '[U-13C; U-15N]' 1 'Na acetate' 20 mM ? 1 NaCl 150 mM ? 1 CaCl2 20 mM ? 1 DTT 1 mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 301 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' # _pdbx_nmr_refine.entry_id 2K3H _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Rochus Keller' 'chemical shift assignment' CARA ? 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 2 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 3 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 371 ? A GLU 1 2 1 Y 1 A ALA 372 ? A ALA 2 3 1 Y 1 A ASN 373 ? A ASN 3 4 1 Y 1 A SER 374 ? A SER 4 5 1 Y 1 A TYR 375 ? A TYR 5 6 1 Y 1 A ASP 376 ? A ASP 6 7 1 Y 1 A SER 377 ? A SER 7 8 1 Y 1 A ASP 378 ? A ASP 8 9 1 Y 1 A GLU 379 ? A GLU 9 10 1 Y 1 A ALA 380 ? A ALA 10 11 1 Y 1 A THR 381 ? A THR 11 12 1 Y 1 A THR 382 ? A THR 12 13 1 Y 1 A LEU 383 ? A LEU 13 14 2 Y 1 A GLU 371 ? A GLU 1 15 2 Y 1 A ALA 372 ? A ALA 2 16 2 Y 1 A ASN 373 ? A ASN 3 17 2 Y 1 A SER 374 ? A SER 4 18 2 Y 1 A TYR 375 ? A TYR 5 19 2 Y 1 A ASP 376 ? A ASP 6 20 2 Y 1 A SER 377 ? A SER 7 21 2 Y 1 A ASP 378 ? A ASP 8 22 2 Y 1 A GLU 379 ? A GLU 9 23 2 Y 1 A ALA 380 ? A ALA 10 24 2 Y 1 A THR 381 ? A THR 11 25 2 Y 1 A THR 382 ? A THR 12 26 2 Y 1 A LEU 383 ? A LEU 13 27 3 Y 1 A GLU 371 ? A GLU 1 28 3 Y 1 A ALA 372 ? A ALA 2 29 3 Y 1 A ASN 373 ? A ASN 3 30 3 Y 1 A SER 374 ? A SER 4 31 3 Y 1 A TYR 375 ? A TYR 5 32 3 Y 1 A ASP 376 ? A ASP 6 33 3 Y 1 A SER 377 ? A SER 7 34 3 Y 1 A ASP 378 ? A ASP 8 35 3 Y 1 A GLU 379 ? A GLU 9 36 3 Y 1 A ALA 380 ? A ALA 10 37 3 Y 1 A THR 381 ? A THR 11 38 3 Y 1 A THR 382 ? A THR 12 39 3 Y 1 A LEU 383 ? A LEU 13 40 4 Y 1 A GLU 371 ? A GLU 1 41 4 Y 1 A ALA 372 ? A ALA 2 42 4 Y 1 A ASN 373 ? A ASN 3 43 4 Y 1 A SER 374 ? A SER 4 44 4 Y 1 A TYR 375 ? A TYR 5 45 4 Y 1 A ASP 376 ? A ASP 6 46 4 Y 1 A SER 377 ? A SER 7 47 4 Y 1 A ASP 378 ? A ASP 8 48 4 Y 1 A GLU 379 ? A GLU 9 49 4 Y 1 A ALA 380 ? A ALA 10 50 4 Y 1 A THR 381 ? A THR 11 51 4 Y 1 A THR 382 ? A THR 12 52 4 Y 1 A LEU 383 ? A LEU 13 53 5 Y 1 A GLU 371 ? A GLU 1 54 5 Y 1 A ALA 372 ? A ALA 2 55 5 Y 1 A ASN 373 ? A ASN 3 56 5 Y 1 A SER 374 ? A SER 4 57 5 Y 1 A TYR 375 ? A TYR 5 58 5 Y 1 A ASP 376 ? A ASP 6 59 5 Y 1 A SER 377 ? A SER 7 60 5 Y 1 A ASP 378 ? A ASP 8 61 5 Y 1 A GLU 379 ? A GLU 9 62 5 Y 1 A ALA 380 ? A ALA 10 63 5 Y 1 A THR 381 ? A THR 11 64 5 Y 1 A THR 382 ? A THR 12 65 5 Y 1 A LEU 383 ? A LEU 13 66 6 Y 1 A GLU 371 ? A GLU 1 67 6 Y 1 A ALA 372 ? A ALA 2 68 6 Y 1 A ASN 373 ? A ASN 3 69 6 Y 1 A SER 374 ? A SER 4 70 6 Y 1 A TYR 375 ? A TYR 5 71 6 Y 1 A ASP 376 ? A ASP 6 72 6 Y 1 A SER 377 ? A SER 7 73 6 Y 1 A ASP 378 ? A ASP 8 74 6 Y 1 A GLU 379 ? A GLU 9 75 6 Y 1 A ALA 380 ? A ALA 10 76 6 Y 1 A THR 381 ? A THR 11 77 6 Y 1 A THR 382 ? A THR 12 78 6 Y 1 A LEU 383 ? A LEU 13 79 7 Y 1 A GLU 371 ? A GLU 1 80 7 Y 1 A ALA 372 ? A ALA 2 81 7 Y 1 A ASN 373 ? A ASN 3 82 7 Y 1 A SER 374 ? A SER 4 83 7 Y 1 A TYR 375 ? A TYR 5 84 7 Y 1 A ASP 376 ? A ASP 6 85 7 Y 1 A SER 377 ? A SER 7 86 7 Y 1 A ASP 378 ? A ASP 8 87 7 Y 1 A GLU 379 ? A GLU 9 88 7 Y 1 A ALA 380 ? A ALA 10 89 7 Y 1 A THR 381 ? A THR 11 90 7 Y 1 A THR 382 ? A THR 12 91 7 Y 1 A LEU 383 ? A LEU 13 92 8 Y 1 A GLU 371 ? A GLU 1 93 8 Y 1 A ALA 372 ? A ALA 2 94 8 Y 1 A ASN 373 ? A ASN 3 95 8 Y 1 A SER 374 ? A SER 4 96 8 Y 1 A TYR 375 ? A TYR 5 97 8 Y 1 A ASP 376 ? A ASP 6 98 8 Y 1 A SER 377 ? A SER 7 99 8 Y 1 A ASP 378 ? A ASP 8 100 8 Y 1 A GLU 379 ? A GLU 9 101 8 Y 1 A ALA 380 ? A ALA 10 102 8 Y 1 A THR 381 ? A THR 11 103 8 Y 1 A THR 382 ? A THR 12 104 8 Y 1 A LEU 383 ? A LEU 13 105 9 Y 1 A GLU 371 ? A GLU 1 106 9 Y 1 A ALA 372 ? A ALA 2 107 9 Y 1 A ASN 373 ? A ASN 3 108 9 Y 1 A SER 374 ? A SER 4 109 9 Y 1 A TYR 375 ? A TYR 5 110 9 Y 1 A ASP 376 ? A ASP 6 111 9 Y 1 A SER 377 ? A SER 7 112 9 Y 1 A ASP 378 ? A ASP 8 113 9 Y 1 A GLU 379 ? A GLU 9 114 9 Y 1 A ALA 380 ? A ALA 10 115 9 Y 1 A THR 381 ? A THR 11 116 9 Y 1 A THR 382 ? A THR 12 117 9 Y 1 A LEU 383 ? A LEU 13 118 10 Y 1 A GLU 371 ? A GLU 1 119 10 Y 1 A ALA 372 ? A ALA 2 120 10 Y 1 A ASN 373 ? A ASN 3 121 10 Y 1 A SER 374 ? A SER 4 122 10 Y 1 A TYR 375 ? A TYR 5 123 10 Y 1 A ASP 376 ? A ASP 6 124 10 Y 1 A SER 377 ? A SER 7 125 10 Y 1 A ASP 378 ? A ASP 8 126 10 Y 1 A GLU 379 ? A GLU 9 127 10 Y 1 A ALA 380 ? A ALA 10 128 10 Y 1 A THR 381 ? A THR 11 129 10 Y 1 A THR 382 ? A THR 12 130 10 Y 1 A LEU 383 ? A LEU 13 131 11 Y 1 A GLU 371 ? A GLU 1 132 11 Y 1 A ALA 372 ? A ALA 2 133 11 Y 1 A ASN 373 ? A ASN 3 134 11 Y 1 A SER 374 ? A SER 4 135 11 Y 1 A TYR 375 ? A TYR 5 136 11 Y 1 A ASP 376 ? A ASP 6 137 11 Y 1 A SER 377 ? A SER 7 138 11 Y 1 A ASP 378 ? A ASP 8 139 11 Y 1 A GLU 379 ? A GLU 9 140 11 Y 1 A ALA 380 ? A ALA 10 141 11 Y 1 A THR 381 ? A THR 11 142 11 Y 1 A THR 382 ? A THR 12 143 11 Y 1 A LEU 383 ? A LEU 13 144 12 Y 1 A GLU 371 ? A GLU 1 145 12 Y 1 A ALA 372 ? A ALA 2 146 12 Y 1 A ASN 373 ? A ASN 3 147 12 Y 1 A SER 374 ? A SER 4 148 12 Y 1 A TYR 375 ? A TYR 5 149 12 Y 1 A ASP 376 ? A ASP 6 150 12 Y 1 A SER 377 ? A SER 7 151 12 Y 1 A ASP 378 ? A ASP 8 152 12 Y 1 A GLU 379 ? A GLU 9 153 12 Y 1 A ALA 380 ? A ALA 10 154 12 Y 1 A THR 381 ? A THR 11 155 12 Y 1 A THR 382 ? A THR 12 156 12 Y 1 A LEU 383 ? A LEU 13 157 13 Y 1 A GLU 371 ? A GLU 1 158 13 Y 1 A ALA 372 ? A ALA 2 159 13 Y 1 A ASN 373 ? A ASN 3 160 13 Y 1 A SER 374 ? A SER 4 161 13 Y 1 A TYR 375 ? A TYR 5 162 13 Y 1 A ASP 376 ? A ASP 6 163 13 Y 1 A SER 377 ? A SER 7 164 13 Y 1 A ASP 378 ? A ASP 8 165 13 Y 1 A GLU 379 ? A GLU 9 166 13 Y 1 A ALA 380 ? A ALA 10 167 13 Y 1 A THR 381 ? A THR 11 168 13 Y 1 A THR 382 ? A THR 12 169 13 Y 1 A LEU 383 ? A LEU 13 170 14 Y 1 A GLU 371 ? A GLU 1 171 14 Y 1 A ALA 372 ? A ALA 2 172 14 Y 1 A ASN 373 ? A ASN 3 173 14 Y 1 A SER 374 ? A SER 4 174 14 Y 1 A TYR 375 ? A TYR 5 175 14 Y 1 A ASP 376 ? A ASP 6 176 14 Y 1 A SER 377 ? A SER 7 177 14 Y 1 A ASP 378 ? A ASP 8 178 14 Y 1 A GLU 379 ? A GLU 9 179 14 Y 1 A ALA 380 ? A ALA 10 180 14 Y 1 A THR 381 ? A THR 11 181 14 Y 1 A THR 382 ? A THR 12 182 14 Y 1 A LEU 383 ? A LEU 13 183 15 Y 1 A GLU 371 ? A GLU 1 184 15 Y 1 A ALA 372 ? A ALA 2 185 15 Y 1 A ASN 373 ? A ASN 3 186 15 Y 1 A SER 374 ? A SER 4 187 15 Y 1 A TYR 375 ? A TYR 5 188 15 Y 1 A ASP 376 ? A ASP 6 189 15 Y 1 A SER 377 ? A SER 7 190 15 Y 1 A ASP 378 ? A ASP 8 191 15 Y 1 A GLU 379 ? A GLU 9 192 15 Y 1 A ALA 380 ? A ALA 10 193 15 Y 1 A THR 381 ? A THR 11 194 15 Y 1 A THR 382 ? A THR 12 195 15 Y 1 A LEU 383 ? A LEU 13 196 16 Y 1 A GLU 371 ? A GLU 1 197 16 Y 1 A ALA 372 ? A ALA 2 198 16 Y 1 A ASN 373 ? A ASN 3 199 16 Y 1 A SER 374 ? A SER 4 200 16 Y 1 A TYR 375 ? A TYR 5 201 16 Y 1 A ASP 376 ? A ASP 6 202 16 Y 1 A SER 377 ? A SER 7 203 16 Y 1 A ASP 378 ? A ASP 8 204 16 Y 1 A GLU 379 ? A GLU 9 205 16 Y 1 A ALA 380 ? A ALA 10 206 16 Y 1 A THR 381 ? A THR 11 207 16 Y 1 A THR 382 ? A THR 12 208 16 Y 1 A LEU 383 ? A LEU 13 209 17 Y 1 A GLU 371 ? A GLU 1 210 17 Y 1 A ALA 372 ? A ALA 2 211 17 Y 1 A ASN 373 ? A ASN 3 212 17 Y 1 A SER 374 ? A SER 4 213 17 Y 1 A TYR 375 ? A TYR 5 214 17 Y 1 A ASP 376 ? A ASP 6 215 17 Y 1 A SER 377 ? A SER 7 216 17 Y 1 A ASP 378 ? A ASP 8 217 17 Y 1 A GLU 379 ? A GLU 9 218 17 Y 1 A ALA 380 ? A ALA 10 219 17 Y 1 A THR 381 ? A THR 11 220 17 Y 1 A THR 382 ? A THR 12 221 17 Y 1 A LEU 383 ? A LEU 13 222 18 Y 1 A GLU 371 ? A GLU 1 223 18 Y 1 A ALA 372 ? A ALA 2 224 18 Y 1 A ASN 373 ? A ASN 3 225 18 Y 1 A SER 374 ? A SER 4 226 18 Y 1 A TYR 375 ? A TYR 5 227 18 Y 1 A ASP 376 ? A ASP 6 228 18 Y 1 A SER 377 ? A SER 7 229 18 Y 1 A ASP 378 ? A ASP 8 230 18 Y 1 A GLU 379 ? A GLU 9 231 18 Y 1 A ALA 380 ? A ALA 10 232 18 Y 1 A THR 381 ? A THR 11 233 18 Y 1 A THR 382 ? A THR 12 234 18 Y 1 A LEU 383 ? A LEU 13 235 19 Y 1 A GLU 371 ? A GLU 1 236 19 Y 1 A ALA 372 ? A ALA 2 237 19 Y 1 A ASN 373 ? A ASN 3 238 19 Y 1 A SER 374 ? A SER 4 239 19 Y 1 A TYR 375 ? A TYR 5 240 19 Y 1 A ASP 376 ? A ASP 6 241 19 Y 1 A SER 377 ? A SER 7 242 19 Y 1 A ASP 378 ? A ASP 8 243 19 Y 1 A GLU 379 ? A GLU 9 244 19 Y 1 A ALA 380 ? A ALA 10 245 19 Y 1 A THR 381 ? A THR 11 246 19 Y 1 A THR 382 ? A THR 12 247 19 Y 1 A LEU 383 ? A LEU 13 248 20 Y 1 A GLU 371 ? A GLU 1 249 20 Y 1 A ALA 372 ? A ALA 2 250 20 Y 1 A ASN 373 ? A ASN 3 251 20 Y 1 A SER 374 ? A SER 4 252 20 Y 1 A TYR 375 ? A TYR 5 253 20 Y 1 A ASP 376 ? A ASP 6 254 20 Y 1 A SER 377 ? A SER 7 255 20 Y 1 A ASP 378 ? A ASP 8 256 20 Y 1 A GLU 379 ? A GLU 9 257 20 Y 1 A ALA 380 ? A ALA 10 258 20 Y 1 A THR 381 ? A THR 11 259 20 Y 1 A THR 382 ? A THR 12 260 20 Y 1 A LEU 383 ? A LEU 13 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 ILE N N N N 159 ILE CA C N S 160 ILE C C N N 161 ILE O O N N 162 ILE CB C N S 163 ILE CG1 C N N 164 ILE CG2 C N N 165 ILE CD1 C N N 166 ILE OXT O N N 167 ILE H H N N 168 ILE H2 H N N 169 ILE HA H N N 170 ILE HB H N N 171 ILE HG12 H N N 172 ILE HG13 H N N 173 ILE HG21 H N N 174 ILE HG22 H N N 175 ILE HG23 H N N 176 ILE HD11 H N N 177 ILE HD12 H N N 178 ILE HD13 H N N 179 ILE HXT H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TRP N N N N 319 TRP CA C N S 320 TRP C C N N 321 TRP O O N N 322 TRP CB C N N 323 TRP CG C Y N 324 TRP CD1 C Y N 325 TRP CD2 C Y N 326 TRP NE1 N Y N 327 TRP CE2 C Y N 328 TRP CE3 C Y N 329 TRP CZ2 C Y N 330 TRP CZ3 C Y N 331 TRP CH2 C Y N 332 TRP OXT O N N 333 TRP H H N N 334 TRP H2 H N N 335 TRP HA H N N 336 TRP HB2 H N N 337 TRP HB3 H N N 338 TRP HD1 H N N 339 TRP HE1 H N N 340 TRP HE3 H N N 341 TRP HZ2 H N N 342 TRP HZ3 H N N 343 TRP HH2 H N N 344 TRP HXT H N N 345 TYR N N N N 346 TYR CA C N S 347 TYR C C N N 348 TYR O O N N 349 TYR CB C N N 350 TYR CG C Y N 351 TYR CD1 C Y N 352 TYR CD2 C Y N 353 TYR CE1 C Y N 354 TYR CE2 C Y N 355 TYR CZ C Y N 356 TYR OH O N N 357 TYR OXT O N N 358 TYR H H N N 359 TYR H2 H N N 360 TYR HA H N N 361 TYR HB2 H N N 362 TYR HB3 H N N 363 TYR HD1 H N N 364 TYR HD2 H N N 365 TYR HE1 H N N 366 TYR HE2 H N N 367 TYR HH H N N 368 TYR HXT H N N 369 VAL N N N N 370 VAL CA C N S 371 VAL C C N N 372 VAL O O N N 373 VAL CB C N N 374 VAL CG1 C N N 375 VAL CG2 C N N 376 VAL OXT O N N 377 VAL H H N N 378 VAL H2 H N N 379 VAL HA H N N 380 VAL HB H N N 381 VAL HG11 H N N 382 VAL HG12 H N N 383 VAL HG13 H N N 384 VAL HG21 H N N 385 VAL HG22 H N N 386 VAL HG23 H N N 387 VAL HXT H N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 700 Bruker DRX 1 'Bruker DRX' 800 Bruker DRX 2 'Bruker DRX' 600 Bruker DRX 3 'Bruker DRX' # _atom_sites.entry_id 2K3H _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_