data_2K3X # _entry.id 2K3X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K3X pdb_00002k3x 10.2210/pdb2k3x/pdb RCSB RCSB100644 ? ? WWPDB D_1000100644 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-09-16 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K3X _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-05-19 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mer, G.' 1 'Xu, C.' 2 # _citation.id primary _citation.title 'Structural Basis for the Recognition of Methylated Histone H3K36 by the Eaf3 Subunit of Histone Deacetylase Complex Rpd3S.' _citation.journal_abbrev Structure _citation.journal_volume 16 _citation.page_first 1740 _citation.page_last 1750 _citation.year 2008 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18818090 _citation.pdbx_database_id_DOI 10.1016/j.str.2008.08.008 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, C.' 1 ? primary 'Cui, G.' 2 ? primary 'Botuyan, M.V.' 3 ? primary 'Mer, G.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Chromatin modification-related protein EAF3' _entity.formula_weight 14103.966 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 1 to 113' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ESA1-associated factor 3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVDLEQEFALGGRCLAFHGPLMYEAKILKIWDPSSKMYTSIPNDKPGGSSQATKEIKPQKLGEDESIPEEIINGKCFFIH YQGWKSSWDEWVGYDRIRAYNEENIAMKKRLANLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MVDLEQEFALGGRCLAFHGPLMYEAKILKIWDPSSKMYTSIPNDKPGGSSQATKEIKPQKLGEDESIPEEIINGKCFFIH YQGWKSSWDEWVGYDRIRAYNEENIAMKKRLANLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 ASP n 1 4 LEU n 1 5 GLU n 1 6 GLN n 1 7 GLU n 1 8 PHE n 1 9 ALA n 1 10 LEU n 1 11 GLY n 1 12 GLY n 1 13 ARG n 1 14 CYS n 1 15 LEU n 1 16 ALA n 1 17 PHE n 1 18 HIS n 1 19 GLY n 1 20 PRO n 1 21 LEU n 1 22 MET n 1 23 TYR n 1 24 GLU n 1 25 ALA n 1 26 LYS n 1 27 ILE n 1 28 LEU n 1 29 LYS n 1 30 ILE n 1 31 TRP n 1 32 ASP n 1 33 PRO n 1 34 SER n 1 35 SER n 1 36 LYS n 1 37 MET n 1 38 TYR n 1 39 THR n 1 40 SER n 1 41 ILE n 1 42 PRO n 1 43 ASN n 1 44 ASP n 1 45 LYS n 1 46 PRO n 1 47 GLY n 1 48 GLY n 1 49 SER n 1 50 SER n 1 51 GLN n 1 52 ALA n 1 53 THR n 1 54 LYS n 1 55 GLU n 1 56 ILE n 1 57 LYS n 1 58 PRO n 1 59 GLN n 1 60 LYS n 1 61 LEU n 1 62 GLY n 1 63 GLU n 1 64 ASP n 1 65 GLU n 1 66 SER n 1 67 ILE n 1 68 PRO n 1 69 GLU n 1 70 GLU n 1 71 ILE n 1 72 ILE n 1 73 ASN n 1 74 GLY n 1 75 LYS n 1 76 CYS n 1 77 PHE n 1 78 PHE n 1 79 ILE n 1 80 HIS n 1 81 TYR n 1 82 GLN n 1 83 GLY n 1 84 TRP n 1 85 LYS n 1 86 SER n 1 87 SER n 1 88 TRP n 1 89 ASP n 1 90 GLU n 1 91 TRP n 1 92 VAL n 1 93 GLY n 1 94 TYR n 1 95 ASP n 1 96 ARG n 1 97 ILE n 1 98 ARG n 1 99 ALA n 1 100 TYR n 1 101 ASN n 1 102 GLU n 1 103 GLU n 1 104 ASN n 1 105 ILE n 1 106 ALA n 1 107 MET n 1 108 LYS n 1 109 LYS n 1 110 ARG n 1 111 LEU n 1 112 ALA n 1 113 ASN n 1 114 LEU n 1 115 GLU n 1 116 HIS n 1 117 HIS n 1 118 HIS n 1 119 HIS n 1 120 HIS n 1 121 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EAF3, YPR023C, YP9367.03C' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector 'pET22b(+)' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 TRP 88 88 88 TRP TRP A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 TRP 91 91 91 TRP TRP A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 HIS 116 116 ? ? ? A . n A 1 117 HIS 117 117 ? ? ? A . n A 1 118 HIS 118 118 ? ? ? A . n A 1 119 HIS 119 119 ? ? ? A . n A 1 120 HIS 120 120 ? ? ? A . n A 1 121 HIS 121 121 ? ? ? A . n # _cell.entry_id 2K3X _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2K3X _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K3X _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K3X _struct.title 'Solution structure of EAF3 chromo barrel domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K3X _struct_keywords.pdbx_keywords 'TRANSCRIPTION REGULATOR' _struct_keywords.text ;Eaf3, Chromo barrel domain, Histone deacetylase, methylated histones H3K36 and H3K4, Chromatin regulator, DNA damage, DNA repair, Nucleus, Phosphoprotein, Transcription, Transcription regulation, TRANSCRIPTION REGULATOR ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EAF3_YEAST _struct_ref.pdbx_db_accession Q12432 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVDLEQEFALGGRCLAFHGPLMYEAKILKIWDPSSKMYTSIPNDKPGGSSQATKEIKPQKLGEDESIPEEIINGKCFFIH YQGWKSSWDEWVGYDRIRAYNEENIAMKKRLAN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K3X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 113 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q12432 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 113 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 113 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K3X LEU A 114 ? UNP Q12432 ? ? 'expression tag' 114 1 1 2K3X GLU A 115 ? UNP Q12432 ? ? 'expression tag' 115 2 1 2K3X HIS A 116 ? UNP Q12432 ? ? 'expression tag' 116 3 1 2K3X HIS A 117 ? UNP Q12432 ? ? 'expression tag' 117 4 1 2K3X HIS A 118 ? UNP Q12432 ? ? 'expression tag' 118 5 1 2K3X HIS A 119 ? UNP Q12432 ? ? 'expression tag' 119 6 1 2K3X HIS A 120 ? UNP Q12432 ? ? 'expression tag' 120 7 1 2K3X HIS A 121 ? UNP Q12432 ? ? 'expression tag' 121 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 68 ? ASN A 73 ? PRO A 68 ASN A 73 1 ? 6 HELX_P HELX_P2 2 LYS A 85 ? ASP A 89 ? LYS A 85 ASP A 89 5 ? 5 HELX_P HELX_P3 3 ASN A 101 ? ASN A 113 ? ASN A 101 ASN A 113 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 38 ? THR A 39 ? TYR A 38 THR A 39 A 2 MET A 22 ? TRP A 31 ? MET A 22 TRP A 31 A 3 CYS A 76 ? ILE A 79 ? CYS A 76 ILE A 79 A 4 GLU A 90 ? GLY A 93 ? GLU A 90 GLY A 93 B 1 TYR A 38 ? THR A 39 ? TYR A 38 THR A 39 B 2 MET A 22 ? TRP A 31 ? MET A 22 TRP A 31 B 3 ARG A 13 ? PHE A 17 ? ARG A 13 PHE A 17 B 4 ILE A 97 ? ALA A 99 ? ILE A 97 ALA A 99 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 39 ? O THR A 39 N ILE A 30 ? N ILE A 30 A 2 3 N LYS A 29 ? N LYS A 29 O PHE A 78 ? O PHE A 78 A 3 4 N ILE A 79 ? N ILE A 79 O GLU A 90 ? O GLU A 90 B 1 2 O THR A 39 ? O THR A 39 N ILE A 30 ? N ILE A 30 B 2 3 O ALA A 25 ? O ALA A 25 N CYS A 14 ? N CYS A 14 B 3 4 N LEU A 15 ? N LEU A 15 O ARG A 98 ? O ARG A 98 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A TYR 38 ? ? CG A TYR 38 ? ? CD2 A TYR 38 ? ? 117.33 121.00 -3.67 0.60 N 2 2 CB A TYR 38 ? ? CG A TYR 38 ? ? CD2 A TYR 38 ? ? 117.32 121.00 -3.68 0.60 N 3 3 CA A ILE 67 ? ? CB A ILE 67 ? ? CG1 A ILE 67 ? ? 124.56 111.00 13.56 1.90 N 4 16 CB A TYR 38 ? ? CG A TYR 38 ? ? CD2 A TYR 38 ? ? 117.17 121.00 -3.83 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 4 ? ? 64.16 -47.95 2 1 LEU A 28 ? ? -141.32 -63.21 3 1 ASP A 44 ? ? -147.92 -139.43 4 1 THR A 53 ? ? 47.28 -76.28 5 1 GLU A 55 ? ? -65.64 96.30 6 1 ASP A 64 ? ? -156.84 5.66 7 1 ASN A 73 ? ? -68.85 6.84 8 1 ASP A 89 ? ? -65.14 99.00 9 2 ASP A 3 ? ? -152.97 -51.85 10 2 LEU A 28 ? ? -136.96 -63.66 11 2 TYR A 38 ? ? -109.29 -163.13 12 2 ASN A 43 ? ? -68.68 0.15 13 2 GLU A 55 ? ? -25.19 95.47 14 2 ASP A 64 ? ? -158.10 12.75 15 2 ASN A 73 ? ? -67.60 4.92 16 2 ASP A 89 ? ? -68.74 98.60 17 3 ASP A 3 ? ? -146.75 -23.22 18 3 LEU A 28 ? ? -132.34 -52.60 19 3 TYR A 38 ? ? -106.03 -168.77 20 3 GLU A 55 ? ? -25.71 96.28 21 3 ASP A 64 ? ? -163.54 -1.52 22 3 SER A 66 ? ? -35.06 115.47 23 3 TRP A 88 ? ? -77.56 42.52 24 4 LEU A 28 ? ? -120.87 -81.83 25 4 TYR A 38 ? ? -118.18 -168.92 26 4 LYS A 54 ? ? 54.74 172.06 27 4 ASP A 64 ? ? -162.42 -27.61 28 4 ASN A 73 ? ? -65.96 4.33 29 4 TYR A 81 ? ? -69.49 96.74 30 4 TRP A 88 ? ? -79.95 25.43 31 4 ASP A 89 ? ? -68.44 98.69 32 5 GLU A 5 ? ? -132.62 -34.51 33 5 LEU A 28 ? ? -138.35 -52.00 34 5 ASP A 44 ? ? 57.38 -79.19 35 5 PRO A 46 ? ? -59.39 -72.14 36 5 ALA A 52 ? ? -105.57 61.92 37 5 LYS A 54 ? ? 48.55 -173.03 38 5 ASP A 64 ? ? -167.97 38.96 39 5 GLU A 65 ? ? -146.43 28.35 40 5 ASN A 73 ? ? -67.84 1.64 41 5 ASP A 89 ? ? -67.25 95.17 42 6 LEU A 4 ? ? 64.43 -50.49 43 6 LEU A 28 ? ? -133.88 -73.17 44 6 LYS A 54 ? ? 61.18 -177.97 45 6 LYS A 60 ? ? -49.60 150.72 46 6 GLU A 65 ? ? -146.31 26.36 47 6 ASN A 73 ? ? -69.47 2.57 48 6 ASP A 89 ? ? -66.00 96.65 49 7 HIS A 18 ? ? -130.88 -42.48 50 7 LEU A 28 ? ? -136.44 -71.22 51 7 TYR A 38 ? ? -112.36 -161.93 52 7 THR A 39 ? ? -173.06 146.32 53 7 PRO A 42 ? ? -79.24 33.92 54 7 ASP A 44 ? ? 67.09 -24.12 55 7 LYS A 45 ? ? 70.44 152.95 56 7 ALA A 52 ? ? -117.40 66.00 57 7 THR A 53 ? ? -38.63 106.80 58 7 LYS A 54 ? ? 49.83 -174.61 59 7 ASP A 64 ? ? -155.47 7.97 60 7 ASP A 89 ? ? -64.62 96.54 61 8 ASP A 3 ? ? 71.66 -39.46 62 8 LEU A 28 ? ? -138.25 -59.09 63 8 TYR A 38 ? ? -120.01 -167.20 64 8 ASP A 64 ? ? -156.82 -33.51 65 9 LEU A 28 ? ? -134.50 -72.42 66 9 PRO A 42 ? ? -67.13 24.19 67 9 LYS A 54 ? ? 55.11 -173.30 68 9 ASP A 64 ? ? -167.57 -16.91 69 9 SER A 66 ? ? -33.70 115.93 70 9 ASN A 73 ? ? -66.90 2.72 71 9 ASP A 89 ? ? -66.16 97.88 72 10 VAL A 2 ? ? 52.08 -34.00 73 10 GLN A 6 ? ? -158.71 -93.52 74 10 GLU A 7 ? ? 50.92 -147.62 75 10 LEU A 28 ? ? -99.26 -69.81 76 10 LYS A 54 ? ? -48.37 155.85 77 10 GLU A 55 ? ? -37.05 104.82 78 10 ASP A 64 ? ? -155.93 7.38 79 10 ASN A 73 ? ? -68.94 5.66 80 11 LEU A 4 ? ? 64.95 -42.06 81 11 LEU A 28 ? ? -140.48 -51.93 82 11 TYR A 38 ? ? -119.52 -167.61 83 11 PRO A 42 ? ? -65.29 97.23 84 11 ASP A 44 ? ? -164.52 -163.82 85 11 GLN A 51 ? ? -150.10 19.93 86 11 THR A 53 ? ? -39.07 106.65 87 11 LYS A 54 ? ? 51.30 -173.48 88 11 GLU A 55 ? ? -61.23 99.93 89 11 LEU A 61 ? ? 57.52 179.30 90 11 ASP A 64 ? ? -158.61 -1.62 91 11 ASN A 73 ? ? -68.95 3.56 92 12 LEU A 4 ? ? 64.79 -52.26 93 12 HIS A 18 ? ? -133.02 -43.76 94 12 LEU A 28 ? ? -143.28 -58.58 95 12 TYR A 38 ? ? -114.15 -167.53 96 12 THR A 53 ? ? 57.01 -90.48 97 12 ASP A 64 ? ? -155.00 9.33 98 12 ASN A 73 ? ? -67.15 3.24 99 12 ASP A 89 ? ? -69.10 95.49 100 13 VAL A 2 ? ? 37.05 60.69 101 13 LEU A 4 ? ? -140.20 -27.35 102 13 GLN A 51 ? ? 49.23 17.71 103 13 THR A 53 ? ? 63.58 -86.20 104 13 GLU A 63 ? ? -90.04 49.28 105 13 SER A 66 ? ? -39.66 117.37 106 14 LEU A 28 ? ? -142.41 -55.98 107 14 ASP A 44 ? ? 66.88 151.56 108 14 LYS A 45 ? ? 70.64 55.81 109 14 SER A 50 ? ? 178.34 -74.34 110 14 THR A 53 ? ? 60.44 -94.64 111 14 LYS A 54 ? ? -162.19 -165.67 112 14 ASP A 64 ? ? -153.56 -6.38 113 14 ASP A 89 ? ? -68.84 95.29 114 15 LEU A 28 ? ? -140.50 -60.00 115 15 TYR A 38 ? ? -121.66 -167.09 116 15 THR A 53 ? ? 40.31 -87.79 117 15 GLU A 55 ? ? -59.63 103.66 118 15 LEU A 61 ? ? 57.79 176.76 119 15 ASP A 64 ? ? -152.96 -7.52 120 15 ASP A 89 ? ? -67.42 98.03 121 16 ASP A 3 ? ? -147.68 -39.03 122 16 LEU A 28 ? ? -134.46 -62.72 123 16 TYR A 38 ? ? -114.28 -168.26 124 16 PRO A 42 ? ? -78.48 33.20 125 16 THR A 53 ? ? 55.07 -74.30 126 16 GLU A 55 ? ? -64.71 96.58 127 16 ASP A 64 ? ? -155.57 7.18 128 16 ASP A 89 ? ? -66.29 95.90 129 17 HIS A 18 ? ? -120.73 -55.05 130 17 LEU A 28 ? ? -130.90 -68.84 131 17 SER A 50 ? ? -78.68 -162.06 132 17 ALA A 52 ? ? -75.96 24.86 133 17 THR A 53 ? ? 58.65 -76.68 134 17 GLU A 55 ? ? -66.41 96.02 135 17 ASP A 64 ? ? -161.00 -15.43 136 17 GLU A 65 ? ? -96.96 52.58 137 17 LYS A 75 ? ? 60.61 156.18 138 17 TRP A 88 ? ? -80.24 44.29 139 18 HIS A 18 ? ? -134.13 -41.58 140 18 LEU A 28 ? ? -133.88 -61.31 141 18 TYR A 38 ? ? -110.70 -162.61 142 18 ASN A 43 ? ? -67.76 2.33 143 18 LYS A 54 ? ? 52.46 175.97 144 18 GLU A 63 ? ? 49.39 20.09 145 18 TRP A 88 ? ? -78.64 28.25 146 19 LEU A 28 ? ? -130.00 -60.53 147 19 TYR A 38 ? ? -106.17 -165.10 148 19 PRO A 46 ? ? -70.41 -169.24 149 19 SER A 49 ? ? 57.23 179.77 150 19 THR A 53 ? ? 46.67 -95.23 151 19 GLU A 65 ? ? -149.89 25.53 152 19 LYS A 75 ? ? 58.70 160.33 153 19 ASP A 89 ? ? -66.12 97.54 154 20 LEU A 28 ? ? -124.50 -67.55 155 20 TYR A 38 ? ? -112.47 -167.22 156 20 LYS A 45 ? ? 62.53 124.32 157 20 SER A 50 ? ? 64.35 169.34 158 20 THR A 53 ? ? -39.22 116.96 159 20 LYS A 54 ? ? 52.19 -178.58 160 20 ASP A 64 ? ? -152.63 1.13 161 20 ASP A 89 ? ? -67.44 99.07 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 23 ? ? 0.066 'SIDE CHAIN' 2 1 TYR A 81 ? ? 0.066 'SIDE CHAIN' 3 1 ARG A 96 ? ? 0.113 'SIDE CHAIN' 4 2 TYR A 23 ? ? 0.067 'SIDE CHAIN' 5 2 TYR A 94 ? ? 0.096 'SIDE CHAIN' 6 3 TYR A 81 ? ? 0.107 'SIDE CHAIN' 7 3 TYR A 94 ? ? 0.070 'SIDE CHAIN' 8 4 TYR A 81 ? ? 0.099 'SIDE CHAIN' 9 4 TYR A 94 ? ? 0.063 'SIDE CHAIN' 10 5 TYR A 81 ? ? 0.064 'SIDE CHAIN' 11 5 TYR A 94 ? ? 0.081 'SIDE CHAIN' 12 6 TYR A 81 ? ? 0.068 'SIDE CHAIN' 13 6 TYR A 94 ? ? 0.068 'SIDE CHAIN' 14 7 TYR A 81 ? ? 0.077 'SIDE CHAIN' 15 7 TYR A 94 ? ? 0.137 'SIDE CHAIN' 16 8 TYR A 81 ? ? 0.079 'SIDE CHAIN' 17 8 TYR A 94 ? ? 0.064 'SIDE CHAIN' 18 9 TYR A 81 ? ? 0.063 'SIDE CHAIN' 19 9 TYR A 94 ? ? 0.074 'SIDE CHAIN' 20 10 TYR A 81 ? ? 0.097 'SIDE CHAIN' 21 10 TYR A 94 ? ? 0.061 'SIDE CHAIN' 22 10 ARG A 96 ? ? 0.110 'SIDE CHAIN' 23 11 TYR A 23 ? ? 0.068 'SIDE CHAIN' 24 11 TYR A 94 ? ? 0.093 'SIDE CHAIN' 25 12 TYR A 81 ? ? 0.076 'SIDE CHAIN' 26 12 TYR A 94 ? ? 0.106 'SIDE CHAIN' 27 13 TYR A 81 ? ? 0.108 'SIDE CHAIN' 28 13 TYR A 94 ? ? 0.127 'SIDE CHAIN' 29 14 TYR A 81 ? ? 0.068 'SIDE CHAIN' 30 15 TYR A 81 ? ? 0.072 'SIDE CHAIN' 31 15 TYR A 94 ? ? 0.121 'SIDE CHAIN' 32 16 TYR A 81 ? ? 0.102 'SIDE CHAIN' 33 16 TYR A 94 ? ? 0.066 'SIDE CHAIN' 34 17 TYR A 81 ? ? 0.085 'SIDE CHAIN' 35 18 TYR A 81 ? ? 0.066 'SIDE CHAIN' 36 18 TYR A 94 ? ? 0.117 'SIDE CHAIN' 37 20 TYR A 81 ? ? 0.087 'SIDE CHAIN' 38 20 TYR A 94 ? ? 0.142 'SIDE CHAIN' # _pdbx_entry_details.entry_id 2K3X _pdbx_entry_details.nonpolymer_details 'HIS RESIDUES HAVE HYDROGENS ONLY ON THE EPSILON NITROGEN' _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K3X _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K3X _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.4-1.5 mM [U-100% 15N] Eaf3, 20 mM sodium phosphate, 50 mM sodium chloride, 1 mM EDTA, 2 mM DTT, 800 mM urea, 93% H2O/7% D2O' 1 '93% H2O/7% D2O' ;0.4-1.5 mM [U-100% 13C; U-100% 15N] Eaf3, 20 mM sodium phosphate, 50 mM sodium chloride, 1 mM EDTA, 2 mM DTT, 800 mM urea, 93% H2O/7% D2O ; 2 '93% H2O/7% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Eaf3 0.4 mM '[U-100% 15N]' 1 'sodium phosphate' 20 mM ? 1 'sodium chloride' 50 mM ? 1 EDTA 1 mM ? 1 DTT 2 mM ? 1 urea 800 mM ? 1 Eaf3 0.4 mM '[U-100% 13C; U-100% 15N]' 2 'sodium phosphate' 20 mM ? 2 'sodium chloride' 50 mM ? 2 EDTA 1 mM ? 2 DTT 2 mM ? 2 urea 800 mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-15N HSQC' 1 3 2 '2D 1H-13C HSQC' 1 4 1 '3D 1H-15N TOCSY' 1 5 1 '3D 1H-15N NOESY' 1 6 2 '3D HNCACB' 1 7 2 '3D CBCA(CO)NH' 1 8 2 '3D HBHA(CO)NH' 1 9 2 '3D HCCH-TOCSY' 1 10 2 '3D HNCO' 1 11 2 '3D HCACO' 1 12 2 '3D CCH-COSY' 1 13 2 '3D CCH-TOCSY' 1 14 2 '3D C(CO)NH' 1 15 2 '3D H(CCO)NH' 1 16 2 '2D HBCGCDCEHE' 1 17 2 '2D HBCGCDHD' 1 18 2 '3D 1H-13C NOESY' 1 19 2 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_refine.entry_id 2K3X _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 1 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' refinement Amber ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 4 Goddard 'data analysis' Sparky ? 5 'Duggan, Legge, Dyson & Wright' 'data analysis' SANE ? 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 116 ? A HIS 116 2 1 Y 1 A HIS 117 ? A HIS 117 3 1 Y 1 A HIS 118 ? A HIS 118 4 1 Y 1 A HIS 119 ? A HIS 119 5 1 Y 1 A HIS 120 ? A HIS 120 6 1 Y 1 A HIS 121 ? A HIS 121 7 2 Y 1 A HIS 116 ? A HIS 116 8 2 Y 1 A HIS 117 ? A HIS 117 9 2 Y 1 A HIS 118 ? A HIS 118 10 2 Y 1 A HIS 119 ? A HIS 119 11 2 Y 1 A HIS 120 ? A HIS 120 12 2 Y 1 A HIS 121 ? A HIS 121 13 3 Y 1 A HIS 116 ? A HIS 116 14 3 Y 1 A HIS 117 ? A HIS 117 15 3 Y 1 A HIS 118 ? A HIS 118 16 3 Y 1 A HIS 119 ? A HIS 119 17 3 Y 1 A HIS 120 ? A HIS 120 18 3 Y 1 A HIS 121 ? A HIS 121 19 4 Y 1 A HIS 116 ? A HIS 116 20 4 Y 1 A HIS 117 ? A HIS 117 21 4 Y 1 A HIS 118 ? A HIS 118 22 4 Y 1 A HIS 119 ? A HIS 119 23 4 Y 1 A HIS 120 ? A HIS 120 24 4 Y 1 A HIS 121 ? A HIS 121 25 5 Y 1 A HIS 116 ? A HIS 116 26 5 Y 1 A HIS 117 ? A HIS 117 27 5 Y 1 A HIS 118 ? A HIS 118 28 5 Y 1 A HIS 119 ? A HIS 119 29 5 Y 1 A HIS 120 ? A HIS 120 30 5 Y 1 A HIS 121 ? A HIS 121 31 6 Y 1 A HIS 116 ? A HIS 116 32 6 Y 1 A HIS 117 ? A HIS 117 33 6 Y 1 A HIS 118 ? A HIS 118 34 6 Y 1 A HIS 119 ? A HIS 119 35 6 Y 1 A HIS 120 ? A HIS 120 36 6 Y 1 A HIS 121 ? A HIS 121 37 7 Y 1 A HIS 116 ? A HIS 116 38 7 Y 1 A HIS 117 ? A HIS 117 39 7 Y 1 A HIS 118 ? A HIS 118 40 7 Y 1 A HIS 119 ? A HIS 119 41 7 Y 1 A HIS 120 ? A HIS 120 42 7 Y 1 A HIS 121 ? A HIS 121 43 8 Y 1 A HIS 116 ? A HIS 116 44 8 Y 1 A HIS 117 ? A HIS 117 45 8 Y 1 A HIS 118 ? A HIS 118 46 8 Y 1 A HIS 119 ? A HIS 119 47 8 Y 1 A HIS 120 ? A HIS 120 48 8 Y 1 A HIS 121 ? A HIS 121 49 9 Y 1 A HIS 116 ? A HIS 116 50 9 Y 1 A HIS 117 ? A HIS 117 51 9 Y 1 A HIS 118 ? A HIS 118 52 9 Y 1 A HIS 119 ? A HIS 119 53 9 Y 1 A HIS 120 ? A HIS 120 54 9 Y 1 A HIS 121 ? A HIS 121 55 10 Y 1 A HIS 116 ? A HIS 116 56 10 Y 1 A HIS 117 ? A HIS 117 57 10 Y 1 A HIS 118 ? A HIS 118 58 10 Y 1 A HIS 119 ? A HIS 119 59 10 Y 1 A HIS 120 ? A HIS 120 60 10 Y 1 A HIS 121 ? A HIS 121 61 11 Y 1 A HIS 116 ? A HIS 116 62 11 Y 1 A HIS 117 ? A HIS 117 63 11 Y 1 A HIS 118 ? A HIS 118 64 11 Y 1 A HIS 119 ? A HIS 119 65 11 Y 1 A HIS 120 ? A HIS 120 66 11 Y 1 A HIS 121 ? A HIS 121 67 12 Y 1 A HIS 116 ? A HIS 116 68 12 Y 1 A HIS 117 ? A HIS 117 69 12 Y 1 A HIS 118 ? A HIS 118 70 12 Y 1 A HIS 119 ? A HIS 119 71 12 Y 1 A HIS 120 ? A HIS 120 72 12 Y 1 A HIS 121 ? A HIS 121 73 13 Y 1 A HIS 116 ? A HIS 116 74 13 Y 1 A HIS 117 ? A HIS 117 75 13 Y 1 A HIS 118 ? A HIS 118 76 13 Y 1 A HIS 119 ? A HIS 119 77 13 Y 1 A HIS 120 ? A HIS 120 78 13 Y 1 A HIS 121 ? A HIS 121 79 14 Y 1 A HIS 116 ? A HIS 116 80 14 Y 1 A HIS 117 ? A HIS 117 81 14 Y 1 A HIS 118 ? A HIS 118 82 14 Y 1 A HIS 119 ? A HIS 119 83 14 Y 1 A HIS 120 ? A HIS 120 84 14 Y 1 A HIS 121 ? A HIS 121 85 15 Y 1 A HIS 116 ? A HIS 116 86 15 Y 1 A HIS 117 ? A HIS 117 87 15 Y 1 A HIS 118 ? A HIS 118 88 15 Y 1 A HIS 119 ? A HIS 119 89 15 Y 1 A HIS 120 ? A HIS 120 90 15 Y 1 A HIS 121 ? A HIS 121 91 16 Y 1 A HIS 116 ? A HIS 116 92 16 Y 1 A HIS 117 ? A HIS 117 93 16 Y 1 A HIS 118 ? A HIS 118 94 16 Y 1 A HIS 119 ? A HIS 119 95 16 Y 1 A HIS 120 ? A HIS 120 96 16 Y 1 A HIS 121 ? A HIS 121 97 17 Y 1 A HIS 116 ? A HIS 116 98 17 Y 1 A HIS 117 ? A HIS 117 99 17 Y 1 A HIS 118 ? A HIS 118 100 17 Y 1 A HIS 119 ? A HIS 119 101 17 Y 1 A HIS 120 ? A HIS 120 102 17 Y 1 A HIS 121 ? A HIS 121 103 18 Y 1 A HIS 116 ? A HIS 116 104 18 Y 1 A HIS 117 ? A HIS 117 105 18 Y 1 A HIS 118 ? A HIS 118 106 18 Y 1 A HIS 119 ? A HIS 119 107 18 Y 1 A HIS 120 ? A HIS 120 108 18 Y 1 A HIS 121 ? A HIS 121 109 19 Y 1 A HIS 116 ? A HIS 116 110 19 Y 1 A HIS 117 ? A HIS 117 111 19 Y 1 A HIS 118 ? A HIS 118 112 19 Y 1 A HIS 119 ? A HIS 119 113 19 Y 1 A HIS 120 ? A HIS 120 114 19 Y 1 A HIS 121 ? A HIS 121 115 20 Y 1 A HIS 116 ? A HIS 116 116 20 Y 1 A HIS 117 ? A HIS 117 117 20 Y 1 A HIS 118 ? A HIS 118 118 20 Y 1 A HIS 119 ? A HIS 119 119 20 Y 1 A HIS 120 ? A HIS 120 120 20 Y 1 A HIS 121 ? A HIS 121 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 700 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2K3X _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_