data_2K4U
# 
_entry.id   2K4U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2K4U         pdb_00002k4u 10.2210/pdb2k4u/pdb 
RCSB  RCSB100677   ?            ?                   
WWPDB D_1000100677 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-12-09 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2021-11-10 
4 'Structure model' 1 3 2024-11-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
3 3 'Structure model' 'Derived calculations'      
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_2                
2 3 'Structure model' pdbx_struct_assembly      
3 3 'Structure model' pdbx_struct_oper_list     
4 3 'Structure model' struct_ref_seq_dif        
5 4 'Structure model' chem_comp_atom            
6 4 'Structure model' chem_comp_bond            
7 4 'Structure model' pdbx_entry_details        
8 4 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_database_2.pdbx_DOI'                
2 3 'Structure model' '_database_2.pdbx_database_accession' 
3 3 'Structure model' '_struct_ref_seq_dif.details'         
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2K4U 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2008-06-18 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Yin, S.J.'  1  ? 
'Jiang, L.'  2  ? 
'Yi, H.'     3  ? 
'Han, S.'    4  ? 
'Yang, D.W.' 5  ? 
'Liu, M.L.'  6  ? 
'Liu, H.'    7  ? 
'Cao, Z.J.'  8  ? 
'Wu, Y.L.'   9  ? 
'Li, W.X.'   10 ? 
# 
_citation.id                        primary 
_citation.title                     
'Different Residues in Channel Turret Determining the Selectivity of ADWX-1 Inhibitor Peptide between Kv1.1 and Kv1.3 Channels' 
_citation.journal_abbrev            'J.Proteome Res.' 
_citation.journal_volume            7 
_citation.page_first                4890 
_citation.page_last                 4897 
_citation.year                      2008 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1535-3893 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18937510 
_citation.pdbx_database_id_DOI      10.1021/pr800494a 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Yin, S.J.'  1  ? 
primary 'Jiang, L.'  2  ? 
primary 'Yi, H.'     3  ? 
primary 'Han, S.'    4  ? 
primary 'Yang, D.W.' 5  ? 
primary 'Liu, M.L.'  6  ? 
primary 'Liu, H.'    7  ? 
primary 'Cao, Z.J.'  8  ? 
primary 'Wu, Y.L.'   9  ? 
primary 'Li, W.X.'   10 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Potassium channel toxin alpha-KTx 3.6' 
_entity.formula_weight             4088.980 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              G11R,I28T,D33H 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Adwx-1, Kaliotoxin, BmKTX' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK 
_entity_poly.pdbx_seq_one_letter_code_can   VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  VAL n 
1 2  GLY n 
1 3  ILE n 
1 4  ASN n 
1 5  VAL n 
1 6  LYS n 
1 7  CYS n 
1 8  LYS n 
1 9  HIS n 
1 10 SER n 
1 11 ARG n 
1 12 GLN n 
1 13 CYS n 
1 14 LEU n 
1 15 LYS n 
1 16 PRO n 
1 17 CYS n 
1 18 LYS n 
1 19 ASP n 
1 20 ALA n 
1 21 GLY n 
1 22 MET n 
1 23 ARG n 
1 24 PHE n 
1 25 GLY n 
1 26 LYS n 
1 27 CYS n 
1 28 THR n 
1 29 ASN n 
1 30 GLY n 
1 31 LYS n 
1 32 CYS n 
1 33 HIS n 
1 34 CYS n 
1 35 THR n 
1 36 PRO n 
1 37 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Chinese scorpion' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mesobuthus martensii' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     34649 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pGEX-6p-1 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  VAL 1  1  1  VAL VAL A . n 
A 1 2  GLY 2  2  2  GLY GLY A . n 
A 1 3  ILE 3  3  3  ILE ILE A . n 
A 1 4  ASN 4  4  4  ASN ASN A . n 
A 1 5  VAL 5  5  5  VAL VAL A . n 
A 1 6  LYS 6  6  6  LYS LYS A . n 
A 1 7  CYS 7  7  7  CYS CYS A . n 
A 1 8  LYS 8  8  8  LYS LYS A . n 
A 1 9  HIS 9  9  9  HIS HIS A . n 
A 1 10 SER 10 10 10 SER SER A . n 
A 1 11 ARG 11 11 11 ARG ARG A . n 
A 1 12 GLN 12 12 12 GLN GLN A . n 
A 1 13 CYS 13 13 13 CYS CYS A . n 
A 1 14 LEU 14 14 14 LEU LEU A . n 
A 1 15 LYS 15 15 15 LYS LYS A . n 
A 1 16 PRO 16 16 16 PRO PRO A . n 
A 1 17 CYS 17 17 17 CYS CYS A . n 
A 1 18 LYS 18 18 18 LYS LYS A . n 
A 1 19 ASP 19 19 19 ASP ASP A . n 
A 1 20 ALA 20 20 20 ALA ALA A . n 
A 1 21 GLY 21 21 21 GLY GLY A . n 
A 1 22 MET 22 22 22 MET MET A . n 
A 1 23 ARG 23 23 23 ARG ARG A . n 
A 1 24 PHE 24 24 24 PHE PHE A . n 
A 1 25 GLY 25 25 25 GLY GLY A . n 
A 1 26 LYS 26 26 26 LYS LYS A . n 
A 1 27 CYS 27 27 27 CYS CYS A . n 
A 1 28 THR 28 28 28 THR THR A . n 
A 1 29 ASN 29 29 29 ASN ASN A . n 
A 1 30 GLY 30 30 30 GLY GLY A . n 
A 1 31 LYS 31 31 31 LYS LYS A . n 
A 1 32 CYS 32 32 32 CYS CYS A . n 
A 1 33 HIS 33 33 33 HIS HIS A . n 
A 1 34 CYS 34 34 34 CYS CYS A . n 
A 1 35 THR 35 35 35 THR THR A . n 
A 1 36 PRO 36 36 36 PRO PRO A . n 
A 1 37 LYS 37 37 37 LYS LYS A . n 
# 
_cell.entry_id           2K4U 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2K4U 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2K4U 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2K4U 
_struct.title                     'Solution structure of the SCORPION TOXIN ADWX-1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2K4U 
_struct_keywords.pdbx_keywords   TOXIN 
_struct_keywords.text            
;KV1.1 CHANNEL, KV1.3 CHANNEL, CHANNEL TURRET, ADWX-1 PEPTIDE SELECTIVITY, STRUCTURAL BASIS, Amidation, Ionic channel inhibitor, Neurotoxin, Potassium channel inhibitor, Secreted, Toxin
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KAX36_MESMA 
_struct_ref.pdbx_db_accession          Q9NII7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   VGINVKCKHSGQCLKPCKDAGMRFGKCINGKCDCTPK 
_struct_ref.pdbx_align_begin           23 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2K4U 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 37 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9NII7 
_struct_ref_seq.db_align_beg                  23 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  59 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       37 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2K4U ARG A 11 ? UNP Q9NII7 GLY 33 'engineered mutation' 11 1 
1 2K4U THR A 28 ? UNP Q9NII7 ILE 50 'engineered mutation' 28 2 
1 2K4U HIS A 33 ? UNP Q9NII7 ASP 55 'engineered mutation' 33 3 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       SER 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        10 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLY 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        21 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        SER 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         10 
_struct_conf.end_auth_comp_id        GLY 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         21 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 7  SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 7  A CYS 27 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf2 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 13 A CYS 32 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 17 A CYS 34 1_555 ? ? ? ? ? ? ? 2.026 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 CYS A 7  ? CYS A 27 ? CYS A 7  ? 1_555 CYS A 27 ? 1_555 SG SG . . . None 'Disulfide bridge' 
2 CYS A 13 ? CYS A 32 ? CYS A 13 ? 1_555 CYS A 32 ? 1_555 SG SG . . . None 'Disulfide bridge' 
3 CYS A 17 ? CYS A 34 ? CYS A 17 ? 1_555 CYS A 34 ? 1_555 SG SG . . . None 'Disulfide bridge' 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 24 ? THR A 28 ? PHE A 24 THR A 28 
A 2 LYS A 31 ? THR A 35 ? LYS A 31 THR A 35 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   THR 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    28 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    THR 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     28 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   LYS 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    31 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    LYS 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     31 
# 
_pdbx_entry_details.entry_id                   2K4U 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  HIS A 9  ? ? -147.58 -77.35 
2  1  SER A 10 ? ? -179.65 -56.71 
3  1  ARG A 23 ? ? -97.66  -63.89 
4  1  ASN A 29 ? ? 49.88   28.44  
5  2  HIS A 9  ? ? -147.91 -81.58 
6  2  SER A 10 ? ? -173.39 -52.96 
7  3  HIS A 9  ? ? -145.07 -79.88 
8  3  SER A 10 ? ? -178.95 -54.36 
9  4  HIS A 9  ? ? -146.47 -77.48 
10 4  SER A 10 ? ? -178.62 -46.25 
11 5  HIS A 9  ? ? -148.06 -75.72 
12 5  SER A 10 ? ? -177.21 -56.29 
13 6  HIS A 9  ? ? -146.28 -78.23 
14 6  SER A 10 ? ? 179.03  -46.30 
15 6  ARG A 23 ? ? -90.02  -64.52 
16 7  HIS A 9  ? ? -145.23 -77.03 
17 7  SER A 10 ? ? -174.71 -55.57 
18 7  ARG A 23 ? ? -81.83  -70.26 
19 8  HIS A 9  ? ? -144.71 -77.67 
20 8  SER A 10 ? ? 178.46  -53.02 
21 8  ARG A 23 ? ? -91.32  -67.96 
22 9  HIS A 9  ? ? -141.87 -77.42 
23 9  SER A 10 ? ? -179.72 -52.16 
24 9  ARG A 23 ? ? -120.60 -50.20 
25 10 HIS A 9  ? ? -147.55 -77.27 
26 10 SER A 10 ? ? -178.41 -52.77 
27 10 ARG A 23 ? ? -107.76 -64.06 
28 11 HIS A 9  ? ? -146.89 -81.75 
29 11 SER A 10 ? ? -172.85 -48.84 
30 11 ARG A 23 ? ? -90.37  -68.97 
31 12 HIS A 9  ? ? -145.06 -84.56 
32 12 SER A 10 ? ? -170.28 -47.95 
33 12 ARG A 23 ? ? -90.18  -70.21 
34 13 HIS A 9  ? ? -147.41 -77.27 
35 13 SER A 10 ? ? -179.88 -52.56 
36 13 ARG A 23 ? ? -97.47  -68.29 
37 14 HIS A 9  ? ? -149.23 -75.24 
38 14 SER A 10 ? ? -179.04 -53.97 
39 14 ARG A 23 ? ? -88.61  -72.25 
40 15 HIS A 9  ? ? -147.04 -75.62 
41 15 SER A 10 ? ? 175.87  -52.03 
42 15 ARG A 23 ? ? -89.62  -74.46 
43 16 HIS A 9  ? ? -146.99 -79.80 
44 16 SER A 10 ? ? -179.12 -52.97 
45 17 HIS A 9  ? ? -147.31 -74.28 
46 17 SER A 10 ? ? 175.48  -46.01 
47 17 ARG A 23 ? ? -106.81 -63.55 
48 18 HIS A 9  ? ? -147.70 -75.61 
49 18 SER A 10 ? ? 176.20  -52.75 
50 18 ARG A 23 ? ? -90.37  -74.45 
51 19 HIS A 9  ? ? -146.34 -76.82 
52 19 SER A 10 ? ? 176.42  -51.98 
53 19 ARG A 23 ? ? -97.24  -69.81 
54 20 HIS A 9  ? ? -147.03 -77.35 
55 20 SER A 10 ? ? 178.23  -47.60 
56 20 ARG A 23 ? ? -88.69  -71.32 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2K4U 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2K4U 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.contents         '1mM protein, 25mM sodium phosphate, 0.05% sodium azide, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
protein            1    mM ? 1 
'sodium phosphate' 25   mM ? 1 
'sodium azide'     0.05 %  ? 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  4.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         300 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 NOESY 
1 2 1 TOCSY 
# 
_pdbx_nmr_refine.entry_id           2K4U 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            '2,500 STEPS ENERGY MINIMIZATION WITH AMBER FORCE FIELD' 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'P. GUNTERT, ET AL.'             refinement           CYANA 2.1 1 
'Guntert, Mumenthaler, Wuthrich' 'structure solution' CYANA 2.1 2 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLY N    N N N 108 
GLY CA   C N N 109 
GLY C    C N N 110 
GLY O    O N N 111 
GLY OXT  O N N 112 
GLY H    H N N 113 
GLY H2   H N N 114 
GLY HA2  H N N 115 
GLY HA3  H N N 116 
GLY HXT  H N N 117 
HIS N    N N N 118 
HIS CA   C N S 119 
HIS C    C N N 120 
HIS O    O N N 121 
HIS CB   C N N 122 
HIS CG   C Y N 123 
HIS ND1  N Y N 124 
HIS CD2  C Y N 125 
HIS CE1  C Y N 126 
HIS NE2  N Y N 127 
HIS OXT  O N N 128 
HIS H    H N N 129 
HIS H2   H N N 130 
HIS HA   H N N 131 
HIS HB2  H N N 132 
HIS HB3  H N N 133 
HIS HD1  H N N 134 
HIS HD2  H N N 135 
HIS HE1  H N N 136 
HIS HE2  H N N 137 
HIS HXT  H N N 138 
ILE N    N N N 139 
ILE CA   C N S 140 
ILE C    C N N 141 
ILE O    O N N 142 
ILE CB   C N S 143 
ILE CG1  C N N 144 
ILE CG2  C N N 145 
ILE CD1  C N N 146 
ILE OXT  O N N 147 
ILE H    H N N 148 
ILE H2   H N N 149 
ILE HA   H N N 150 
ILE HB   H N N 151 
ILE HG12 H N N 152 
ILE HG13 H N N 153 
ILE HG21 H N N 154 
ILE HG22 H N N 155 
ILE HG23 H N N 156 
ILE HD11 H N N 157 
ILE HD12 H N N 158 
ILE HD13 H N N 159 
ILE HXT  H N N 160 
LEU N    N N N 161 
LEU CA   C N S 162 
LEU C    C N N 163 
LEU O    O N N 164 
LEU CB   C N N 165 
LEU CG   C N N 166 
LEU CD1  C N N 167 
LEU CD2  C N N 168 
LEU OXT  O N N 169 
LEU H    H N N 170 
LEU H2   H N N 171 
LEU HA   H N N 172 
LEU HB2  H N N 173 
LEU HB3  H N N 174 
LEU HG   H N N 175 
LEU HD11 H N N 176 
LEU HD12 H N N 177 
LEU HD13 H N N 178 
LEU HD21 H N N 179 
LEU HD22 H N N 180 
LEU HD23 H N N 181 
LEU HXT  H N N 182 
LYS N    N N N 183 
LYS CA   C N S 184 
LYS C    C N N 185 
LYS O    O N N 186 
LYS CB   C N N 187 
LYS CG   C N N 188 
LYS CD   C N N 189 
LYS CE   C N N 190 
LYS NZ   N N N 191 
LYS OXT  O N N 192 
LYS H    H N N 193 
LYS H2   H N N 194 
LYS HA   H N N 195 
LYS HB2  H N N 196 
LYS HB3  H N N 197 
LYS HG2  H N N 198 
LYS HG3  H N N 199 
LYS HD2  H N N 200 
LYS HD3  H N N 201 
LYS HE2  H N N 202 
LYS HE3  H N N 203 
LYS HZ1  H N N 204 
LYS HZ2  H N N 205 
LYS HZ3  H N N 206 
LYS HXT  H N N 207 
MET N    N N N 208 
MET CA   C N S 209 
MET C    C N N 210 
MET O    O N N 211 
MET CB   C N N 212 
MET CG   C N N 213 
MET SD   S N N 214 
MET CE   C N N 215 
MET OXT  O N N 216 
MET H    H N N 217 
MET H2   H N N 218 
MET HA   H N N 219 
MET HB2  H N N 220 
MET HB3  H N N 221 
MET HG2  H N N 222 
MET HG3  H N N 223 
MET HE1  H N N 224 
MET HE2  H N N 225 
MET HE3  H N N 226 
MET HXT  H N N 227 
PHE N    N N N 228 
PHE CA   C N S 229 
PHE C    C N N 230 
PHE O    O N N 231 
PHE CB   C N N 232 
PHE CG   C Y N 233 
PHE CD1  C Y N 234 
PHE CD2  C Y N 235 
PHE CE1  C Y N 236 
PHE CE2  C Y N 237 
PHE CZ   C Y N 238 
PHE OXT  O N N 239 
PHE H    H N N 240 
PHE H2   H N N 241 
PHE HA   H N N 242 
PHE HB2  H N N 243 
PHE HB3  H N N 244 
PHE HD1  H N N 245 
PHE HD2  H N N 246 
PHE HE1  H N N 247 
PHE HE2  H N N 248 
PHE HZ   H N N 249 
PHE HXT  H N N 250 
PRO N    N N N 251 
PRO CA   C N S 252 
PRO C    C N N 253 
PRO O    O N N 254 
PRO CB   C N N 255 
PRO CG   C N N 256 
PRO CD   C N N 257 
PRO OXT  O N N 258 
PRO H    H N N 259 
PRO HA   H N N 260 
PRO HB2  H N N 261 
PRO HB3  H N N 262 
PRO HG2  H N N 263 
PRO HG3  H N N 264 
PRO HD2  H N N 265 
PRO HD3  H N N 266 
PRO HXT  H N N 267 
SER N    N N N 268 
SER CA   C N S 269 
SER C    C N N 270 
SER O    O N N 271 
SER CB   C N N 272 
SER OG   O N N 273 
SER OXT  O N N 274 
SER H    H N N 275 
SER H2   H N N 276 
SER HA   H N N 277 
SER HB2  H N N 278 
SER HB3  H N N 279 
SER HG   H N N 280 
SER HXT  H N N 281 
THR N    N N N 282 
THR CA   C N S 283 
THR C    C N N 284 
THR O    O N N 285 
THR CB   C N R 286 
THR OG1  O N N 287 
THR CG2  C N N 288 
THR OXT  O N N 289 
THR H    H N N 290 
THR H2   H N N 291 
THR HA   H N N 292 
THR HB   H N N 293 
THR HG1  H N N 294 
THR HG21 H N N 295 
THR HG22 H N N 296 
THR HG23 H N N 297 
THR HXT  H N N 298 
VAL N    N N N 299 
VAL CA   C N S 300 
VAL C    C N N 301 
VAL O    O N N 302 
VAL CB   C N N 303 
VAL CG1  C N N 304 
VAL CG2  C N N 305 
VAL OXT  O N N 306 
VAL H    H N N 307 
VAL H2   H N N 308 
VAL HA   H N N 309 
VAL HB   H N N 310 
VAL HG11 H N N 311 
VAL HG12 H N N 312 
VAL HG13 H N N 313 
VAL HG21 H N N 314 
VAL HG22 H N N 315 
VAL HG23 H N N 316 
VAL HXT  H N N 317 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLY N   CA   sing N N 102 
GLY N   H    sing N N 103 
GLY N   H2   sing N N 104 
GLY CA  C    sing N N 105 
GLY CA  HA2  sing N N 106 
GLY CA  HA3  sing N N 107 
GLY C   O    doub N N 108 
GLY C   OXT  sing N N 109 
GLY OXT HXT  sing N N 110 
HIS N   CA   sing N N 111 
HIS N   H    sing N N 112 
HIS N   H2   sing N N 113 
HIS CA  C    sing N N 114 
HIS CA  CB   sing N N 115 
HIS CA  HA   sing N N 116 
HIS C   O    doub N N 117 
HIS C   OXT  sing N N 118 
HIS CB  CG   sing N N 119 
HIS CB  HB2  sing N N 120 
HIS CB  HB3  sing N N 121 
HIS CG  ND1  sing Y N 122 
HIS CG  CD2  doub Y N 123 
HIS ND1 CE1  doub Y N 124 
HIS ND1 HD1  sing N N 125 
HIS CD2 NE2  sing Y N 126 
HIS CD2 HD2  sing N N 127 
HIS CE1 NE2  sing Y N 128 
HIS CE1 HE1  sing N N 129 
HIS NE2 HE2  sing N N 130 
HIS OXT HXT  sing N N 131 
ILE N   CA   sing N N 132 
ILE N   H    sing N N 133 
ILE N   H2   sing N N 134 
ILE CA  C    sing N N 135 
ILE CA  CB   sing N N 136 
ILE CA  HA   sing N N 137 
ILE C   O    doub N N 138 
ILE C   OXT  sing N N 139 
ILE CB  CG1  sing N N 140 
ILE CB  CG2  sing N N 141 
ILE CB  HB   sing N N 142 
ILE CG1 CD1  sing N N 143 
ILE CG1 HG12 sing N N 144 
ILE CG1 HG13 sing N N 145 
ILE CG2 HG21 sing N N 146 
ILE CG2 HG22 sing N N 147 
ILE CG2 HG23 sing N N 148 
ILE CD1 HD11 sing N N 149 
ILE CD1 HD12 sing N N 150 
ILE CD1 HD13 sing N N 151 
ILE OXT HXT  sing N N 152 
LEU N   CA   sing N N 153 
LEU N   H    sing N N 154 
LEU N   H2   sing N N 155 
LEU CA  C    sing N N 156 
LEU CA  CB   sing N N 157 
LEU CA  HA   sing N N 158 
LEU C   O    doub N N 159 
LEU C   OXT  sing N N 160 
LEU CB  CG   sing N N 161 
LEU CB  HB2  sing N N 162 
LEU CB  HB3  sing N N 163 
LEU CG  CD1  sing N N 164 
LEU CG  CD2  sing N N 165 
LEU CG  HG   sing N N 166 
LEU CD1 HD11 sing N N 167 
LEU CD1 HD12 sing N N 168 
LEU CD1 HD13 sing N N 169 
LEU CD2 HD21 sing N N 170 
LEU CD2 HD22 sing N N 171 
LEU CD2 HD23 sing N N 172 
LEU OXT HXT  sing N N 173 
LYS N   CA   sing N N 174 
LYS N   H    sing N N 175 
LYS N   H2   sing N N 176 
LYS CA  C    sing N N 177 
LYS CA  CB   sing N N 178 
LYS CA  HA   sing N N 179 
LYS C   O    doub N N 180 
LYS C   OXT  sing N N 181 
LYS CB  CG   sing N N 182 
LYS CB  HB2  sing N N 183 
LYS CB  HB3  sing N N 184 
LYS CG  CD   sing N N 185 
LYS CG  HG2  sing N N 186 
LYS CG  HG3  sing N N 187 
LYS CD  CE   sing N N 188 
LYS CD  HD2  sing N N 189 
LYS CD  HD3  sing N N 190 
LYS CE  NZ   sing N N 191 
LYS CE  HE2  sing N N 192 
LYS CE  HE3  sing N N 193 
LYS NZ  HZ1  sing N N 194 
LYS NZ  HZ2  sing N N 195 
LYS NZ  HZ3  sing N N 196 
LYS OXT HXT  sing N N 197 
MET N   CA   sing N N 198 
MET N   H    sing N N 199 
MET N   H2   sing N N 200 
MET CA  C    sing N N 201 
MET CA  CB   sing N N 202 
MET CA  HA   sing N N 203 
MET C   O    doub N N 204 
MET C   OXT  sing N N 205 
MET CB  CG   sing N N 206 
MET CB  HB2  sing N N 207 
MET CB  HB3  sing N N 208 
MET CG  SD   sing N N 209 
MET CG  HG2  sing N N 210 
MET CG  HG3  sing N N 211 
MET SD  CE   sing N N 212 
MET CE  HE1  sing N N 213 
MET CE  HE2  sing N N 214 
MET CE  HE3  sing N N 215 
MET OXT HXT  sing N N 216 
PHE N   CA   sing N N 217 
PHE N   H    sing N N 218 
PHE N   H2   sing N N 219 
PHE CA  C    sing N N 220 
PHE CA  CB   sing N N 221 
PHE CA  HA   sing N N 222 
PHE C   O    doub N N 223 
PHE C   OXT  sing N N 224 
PHE CB  CG   sing N N 225 
PHE CB  HB2  sing N N 226 
PHE CB  HB3  sing N N 227 
PHE CG  CD1  doub Y N 228 
PHE CG  CD2  sing Y N 229 
PHE CD1 CE1  sing Y N 230 
PHE CD1 HD1  sing N N 231 
PHE CD2 CE2  doub Y N 232 
PHE CD2 HD2  sing N N 233 
PHE CE1 CZ   doub Y N 234 
PHE CE1 HE1  sing N N 235 
PHE CE2 CZ   sing Y N 236 
PHE CE2 HE2  sing N N 237 
PHE CZ  HZ   sing N N 238 
PHE OXT HXT  sing N N 239 
PRO N   CA   sing N N 240 
PRO N   CD   sing N N 241 
PRO N   H    sing N N 242 
PRO CA  C    sing N N 243 
PRO CA  CB   sing N N 244 
PRO CA  HA   sing N N 245 
PRO C   O    doub N N 246 
PRO C   OXT  sing N N 247 
PRO CB  CG   sing N N 248 
PRO CB  HB2  sing N N 249 
PRO CB  HB3  sing N N 250 
PRO CG  CD   sing N N 251 
PRO CG  HG2  sing N N 252 
PRO CG  HG3  sing N N 253 
PRO CD  HD2  sing N N 254 
PRO CD  HD3  sing N N 255 
PRO OXT HXT  sing N N 256 
SER N   CA   sing N N 257 
SER N   H    sing N N 258 
SER N   H2   sing N N 259 
SER CA  C    sing N N 260 
SER CA  CB   sing N N 261 
SER CA  HA   sing N N 262 
SER C   O    doub N N 263 
SER C   OXT  sing N N 264 
SER CB  OG   sing N N 265 
SER CB  HB2  sing N N 266 
SER CB  HB3  sing N N 267 
SER OG  HG   sing N N 268 
SER OXT HXT  sing N N 269 
THR N   CA   sing N N 270 
THR N   H    sing N N 271 
THR N   H2   sing N N 272 
THR CA  C    sing N N 273 
THR CA  CB   sing N N 274 
THR CA  HA   sing N N 275 
THR C   O    doub N N 276 
THR C   OXT  sing N N 277 
THR CB  OG1  sing N N 278 
THR CB  CG2  sing N N 279 
THR CB  HB   sing N N 280 
THR OG1 HG1  sing N N 281 
THR CG2 HG21 sing N N 282 
THR CG2 HG22 sing N N 283 
THR CG2 HG23 sing N N 284 
THR OXT HXT  sing N N 285 
VAL N   CA   sing N N 286 
VAL N   H    sing N N 287 
VAL N   H2   sing N N 288 
VAL CA  C    sing N N 289 
VAL CA  CB   sing N N 290 
VAL CA  HA   sing N N 291 
VAL C   O    doub N N 292 
VAL C   OXT  sing N N 293 
VAL CB  CG1  sing N N 294 
VAL CB  CG2  sing N N 295 
VAL CB  HB   sing N N 296 
VAL CG1 HG11 sing N N 297 
VAL CG1 HG12 sing N N 298 
VAL CG1 HG13 sing N N 299 
VAL CG2 HG21 sing N N 300 
VAL CG2 HG22 sing N N 301 
VAL CG2 HG23 sing N N 302 
VAL OXT HXT  sing N N 303 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'VARIAN INOVA' 
# 
_atom_sites.entry_id                    2K4U 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_