data_2K4X # _entry.id 2K4X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K4X pdb_00002k4x 10.2210/pdb2k4x/pdb RCSB RCSB100680 ? ? WWPDB D_1000100680 ? ? BMRB 15811 ? 10.13018/BMR15811 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-08-19 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-05-23 4 'Structure model' 1 3 2020-02-19 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' 8 5 'Structure model' Other 9 6 'Structure model' 'Data collection' 10 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer 5 5 'Structure model' database_2 6 5 'Structure model' pdbx_database_status 7 5 'Structure model' struct_site 8 6 'Structure model' chem_comp_atom 9 6 'Structure model' chem_comp_bond 10 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 7 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 8 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 9 5 'Structure model' '_struct_site.pdbx_auth_seq_id' 10 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K4X _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-06-20 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified TaT88 TargetDB . unspecified 15811 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, B.' 1 'Yee, A.' 2 'Fares, C.' 3 'Lemak, A.' 4 'Semest, A.' 5 'Arrowsmith, C.' 6 'Montelione, G.T.' 7 'Northeast Structural Genomics Consortium (NESG)' 8 'Ontario Centre for Structural Proteomics (OCSP)' 9 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Solution structure of 30S ribosomal protein S27A from Thermoplasma acidophilum/Northeast Structural Genomics Consortium Target TaT88/Ontario Center for Structural Proteomics target ta1093 ; 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'A novel strategy for NMR resonance assignment and protein structure determination.' J.Biomol.Nmr 49 27 38 2011 JBNME9 NE 0925-2738 0800 ? 21161328 10.1007/s10858-010-9458-0 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, B.' 1 ? primary 'Yee, A.' 2 ? primary 'Fares, C.' 3 ? primary 'Lemak, A.' 4 ? primary 'Semest, A.' 5 ? primary 'Arrowsmith, C.' 6 ? 1 'Lemak, A.' 7 ? 1 'Gutmanas, A.' 8 ? 1 'Chitayat, S.' 9 ? 1 'Karra, M.' 10 ? 1 'Fares, C.' 11 ? 1 'Sunnerhagen, M.' 12 ? 1 'Arrowsmith, C.H.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '30S ribosomal protein S27ae' 6397.507 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MQKRELYEIADGKLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKKAKKSKS _entity_poly.pdbx_seq_one_letter_code_can MQKRELYEIADGKLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKKAKKSKS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier TaT88 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLN n 1 3 LYS n 1 4 ARG n 1 5 GLU n 1 6 LEU n 1 7 TYR n 1 8 GLU n 1 9 ILE n 1 10 ALA n 1 11 ASP n 1 12 GLY n 1 13 LYS n 1 14 LEU n 1 15 VAL n 1 16 ARG n 1 17 LYS n 1 18 HIS n 1 19 ARG n 1 20 PHE n 1 21 CYS n 1 22 PRO n 1 23 ARG n 1 24 CYS n 1 25 GLY n 1 26 PRO n 1 27 GLY n 1 28 VAL n 1 29 PHE n 1 30 LEU n 1 31 ALA n 1 32 GLU n 1 33 HIS n 1 34 ALA n 1 35 ASP n 1 36 ARG n 1 37 TYR n 1 38 SER n 1 39 CYS n 1 40 GLY n 1 41 ARG n 1 42 CYS n 1 43 GLY n 1 44 TYR n 1 45 THR n 1 46 GLU n 1 47 PHE n 1 48 LYS n 1 49 LYS n 1 50 ALA n 1 51 LYS n 1 52 LYS n 1 53 SER n 1 54 LYS n 1 55 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermoplasma _entity_src_gen.pdbx_gene_src_gene 'rps27ae, Ta1093' _entity_src_gen.gene_src_species acidophilum _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermoplasma acidophilum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2303 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species coli _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name p11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 SER 55 55 55 SER SER A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 56 _pdbx_nonpoly_scheme.auth_seq_num 56 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K4X _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K4X _struct.title 'Solution structure of 30S ribosomal protein S27A from Thermoplasma acidophilum' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag Y _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K4X _struct_keywords.pdbx_keywords 'RIBOSOMAL PROTEIN' _struct_keywords.text ;30S ribosomal protein S27A, Metal-binding, Ribonucleoprotein, Ribosomal protein, Zinc-finger, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Ontario Centre for Structural Proteomics, OCSP ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RS27A_THEAC _struct_ref.pdbx_db_accession Q9HJ78 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MQKRELYEIADGKLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKKAKKSKS _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K4X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 55 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HJ78 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 55 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 55 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 56 1_555 ? ? ? ? ? ? ? 2.352 ? ? metalc2 metalc ? ? A CYS 24 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 24 A ZN 56 1_555 ? ? ? ? ? ? ? 2.355 ? ? metalc3 metalc ? ? A CYS 39 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 39 A ZN 56 1_555 ? ? ? ? ? ? ? 2.342 ? ? metalc4 metalc ? ? A CYS 42 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 42 A ZN 56 1_555 ? ? ? ? ? ? ? 2.355 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 56 ? 1_555 SG ? A CYS 24 ? A CYS 24 ? 1_555 108.9 ? 2 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 56 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 106.8 ? 3 SG ? A CYS 24 ? A CYS 24 ? 1_555 ZN ? B ZN . ? A ZN 56 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 110.3 ? 4 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 56 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 111.5 ? 5 SG ? A CYS 24 ? A CYS 24 ? 1_555 ZN ? B ZN . ? A ZN 56 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 111.1 ? 6 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? B ZN . ? A ZN 56 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 108.2 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 31 ? GLU A 32 ? ALA A 31 GLU A 32 A 2 ARG A 36 ? SER A 38 ? ARG A 36 SER A 38 A 3 GLU A 46 ? PHE A 47 ? GLU A 46 PHE A 47 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 31 ? N ALA A 31 O SER A 38 ? O SER A 38 A 2 3 N TYR A 37 ? N TYR A 37 O GLU A 46 ? O GLU A 46 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 56 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 56' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 CYS A 21 ? CYS A 21 . ? 1_555 ? 2 AC1 3 CYS A 39 ? CYS A 39 . ? 1_555 ? 3 AC1 3 ARG A 41 ? ARG A 41 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 2 ? ? 67.22 105.15 2 1 LYS A 13 ? ? -63.77 88.31 3 1 PRO A 26 ? ? -65.77 90.79 4 1 ALA A 31 ? ? -52.26 92.33 5 1 ARG A 36 ? ? -171.00 -169.69 6 1 ARG A 41 ? ? -176.94 -51.28 7 1 LYS A 48 ? ? -67.14 90.39 8 2 LYS A 13 ? ? -82.71 38.59 9 2 PRO A 26 ? ? -63.09 81.63 10 2 ARG A 41 ? ? -171.45 -54.43 11 2 LYS A 48 ? ? -52.99 95.59 12 3 TYR A 7 ? ? 62.06 -172.00 13 3 LYS A 17 ? ? -51.31 103.87 14 3 PRO A 26 ? ? -64.61 81.83 15 3 ARG A 41 ? ? 84.27 -51.83 16 3 LYS A 52 ? ? 68.04 107.64 17 4 GLN A 2 ? ? 69.81 109.83 18 4 ARG A 16 ? ? -156.48 -68.25 19 4 LYS A 17 ? ? -69.86 78.51 20 4 HIS A 18 ? ? 164.20 114.15 21 4 PRO A 26 ? ? -61.68 81.81 22 4 ALA A 31 ? ? -59.38 101.82 23 4 ARG A 41 ? ? -173.34 -37.19 24 4 CYS A 42 ? ? -146.48 11.70 25 4 LYS A 48 ? ? -54.33 102.91 26 4 LYS A 49 ? ? -69.19 90.66 27 4 LYS A 52 ? ? 55.39 86.57 28 5 GLN A 2 ? ? -169.85 86.14 29 5 LEU A 6 ? ? 55.65 -166.82 30 5 ILE A 9 ? ? 66.51 100.69 31 5 ALA A 10 ? ? -148.27 21.28 32 5 ARG A 16 ? ? 74.82 -17.00 33 5 LYS A 17 ? ? -68.19 94.97 34 5 HIS A 18 ? ? -160.99 99.22 35 5 PRO A 26 ? ? -64.23 85.14 36 5 ALA A 31 ? ? -63.84 95.83 37 5 ARG A 36 ? ? 179.38 172.96 38 5 ARG A 41 ? ? 74.28 -46.76 39 5 LYS A 48 ? ? -65.59 88.12 40 6 ARG A 4 ? ? -62.76 83.82 41 6 LYS A 13 ? ? 67.52 108.31 42 6 HIS A 18 ? ? 59.71 168.47 43 6 PRO A 26 ? ? -56.57 93.14 44 6 PHE A 29 ? ? -71.03 -165.79 45 6 ARG A 41 ? ? -173.34 -30.10 46 6 CYS A 42 ? ? -150.12 3.82 47 6 ALA A 50 ? ? -69.50 75.29 48 6 SER A 53 ? ? -78.93 -71.75 49 7 GLU A 5 ? ? -140.37 -42.31 50 7 LEU A 6 ? ? 57.20 96.40 51 7 ALA A 10 ? ? -161.27 96.12 52 7 ARG A 16 ? ? 64.94 162.16 53 7 PRO A 26 ? ? -64.74 79.70 54 7 ALA A 31 ? ? -60.90 98.31 55 7 ARG A 41 ? ? -168.98 -60.83 56 7 LYS A 48 ? ? -58.86 107.53 57 7 SER A 53 ? ? -69.51 98.08 58 8 GLU A 5 ? ? -73.80 -86.73 59 8 LYS A 13 ? ? -68.98 95.46 60 8 LEU A 14 ? ? 62.82 -82.03 61 8 PRO A 26 ? ? -66.84 80.14 62 8 PHE A 29 ? ? -74.49 -166.92 63 8 ALA A 31 ? ? -64.85 99.74 64 8 ARG A 36 ? ? 178.32 -175.32 65 8 ARG A 41 ? ? -169.55 -41.29 66 8 LYS A 48 ? ? -68.13 78.38 67 8 ALA A 50 ? ? -63.74 90.91 68 8 LYS A 52 ? ? -151.30 79.50 69 9 LYS A 3 ? ? 68.77 100.64 70 9 TYR A 7 ? ? -164.87 109.01 71 9 ASP A 11 ? ? 50.24 -93.12 72 9 LYS A 13 ? ? 67.56 -173.48 73 9 LEU A 14 ? ? 75.25 130.47 74 9 HIS A 18 ? ? -169.82 89.84 75 9 PRO A 26 ? ? -58.62 90.15 76 9 ALA A 31 ? ? -59.78 104.08 77 9 ARG A 41 ? ? 75.52 -52.29 78 9 ALA A 50 ? ? -82.34 44.40 79 10 LEU A 6 ? ? 60.29 179.46 80 10 GLU A 8 ? ? 64.88 174.74 81 10 ALA A 10 ? ? -130.73 -42.25 82 10 ARG A 16 ? ? 67.57 113.62 83 10 HIS A 18 ? ? 54.60 96.34 84 10 PRO A 26 ? ? -57.53 93.69 85 10 ALA A 31 ? ? -55.19 97.39 86 10 ARG A 41 ? ? 74.69 -50.71 87 10 ALA A 50 ? ? 68.87 127.78 88 10 SER A 53 ? ? 63.31 -178.81 89 11 GLU A 5 ? ? -155.02 -60.27 90 11 ASP A 11 ? ? -168.56 -67.18 91 11 ARG A 16 ? ? -90.81 -89.99 92 11 HIS A 18 ? ? -172.96 28.97 93 11 PRO A 26 ? ? -61.69 83.68 94 11 PHE A 29 ? ? -78.91 -164.60 95 11 ARG A 41 ? ? -159.01 -72.47 96 11 LYS A 48 ? ? -57.77 100.99 97 11 LYS A 49 ? ? -64.15 83.86 98 11 LYS A 54 ? ? 65.23 -162.21 99 12 GLU A 5 ? ? -156.56 17.85 100 12 LEU A 6 ? ? 67.33 168.23 101 12 LYS A 13 ? ? 59.95 174.88 102 12 PRO A 26 ? ? -64.48 81.02 103 12 ALA A 31 ? ? -65.13 89.47 104 12 ARG A 41 ? ? 76.14 -53.55 105 12 LYS A 48 ? ? -64.14 90.79 106 12 LYS A 54 ? ? -69.49 89.41 107 13 GLU A 5 ? ? -88.74 -76.79 108 13 LEU A 6 ? ? 70.14 150.42 109 13 ILE A 9 ? ? 66.94 104.09 110 13 LYS A 13 ? ? -65.03 95.39 111 13 VAL A 15 ? ? -85.04 36.25 112 13 PRO A 26 ? ? -57.29 84.72 113 13 PHE A 29 ? ? -76.43 -163.83 114 13 ALA A 31 ? ? -69.03 89.86 115 13 ARG A 41 ? ? -171.89 -30.68 116 13 CYS A 42 ? ? -147.45 -3.30 117 13 LYS A 54 ? ? 57.77 -82.32 118 14 LEU A 6 ? ? 63.83 -92.60 119 14 HIS A 18 ? ? 47.20 92.40 120 14 PRO A 26 ? ? -53.01 84.09 121 14 ALA A 31 ? ? -55.03 107.48 122 14 ARG A 41 ? ? 75.65 -54.80 123 14 LYS A 52 ? ? 47.37 -94.40 124 14 SER A 53 ? ? -179.38 -47.07 125 15 LEU A 6 ? ? 49.42 -161.90 126 15 GLU A 8 ? ? 66.73 131.93 127 15 ALA A 10 ? ? -151.60 18.26 128 15 LYS A 13 ? ? -87.79 36.19 129 15 PRO A 26 ? ? -60.31 86.11 130 15 ALA A 31 ? ? -57.14 94.86 131 15 ARG A 41 ? ? -160.31 -48.22 132 15 LYS A 48 ? ? -69.75 80.02 133 15 LYS A 52 ? ? 68.68 66.28 134 15 LYS A 54 ? ? 65.78 142.37 135 16 LEU A 6 ? ? 56.35 101.08 136 16 VAL A 15 ? ? -61.02 94.24 137 16 LYS A 17 ? ? 67.65 112.01 138 16 PRO A 26 ? ? -62.75 98.65 139 16 ALA A 31 ? ? -59.21 97.17 140 16 ARG A 41 ? ? 73.50 -48.17 141 16 LYS A 48 ? ? -57.98 88.65 142 16 ALA A 50 ? ? 59.62 -171.21 143 16 LYS A 54 ? ? 64.76 92.74 144 17 LEU A 6 ? ? 68.04 149.97 145 17 ALA A 10 ? ? 62.47 -174.11 146 17 ASP A 11 ? ? 65.82 98.42 147 17 PRO A 26 ? ? -68.02 83.78 148 17 ALA A 31 ? ? -62.62 97.90 149 17 ARG A 41 ? ? -161.04 -29.97 150 17 LYS A 48 ? ? -61.88 93.70 151 18 TYR A 7 ? ? 63.30 -169.00 152 18 VAL A 15 ? ? -103.92 76.65 153 18 ARG A 16 ? ? 57.08 -157.50 154 18 HIS A 18 ? ? 64.69 -175.66 155 18 PRO A 22 ? ? -51.52 -71.48 156 18 PRO A 26 ? ? -60.29 88.57 157 18 ALA A 31 ? ? -66.09 90.23 158 18 ARG A 41 ? ? -168.95 -38.66 159 18 LYS A 51 ? ? -53.93 99.16 160 18 LYS A 52 ? ? -170.93 146.76 161 18 SER A 53 ? ? 74.47 100.36 162 18 LYS A 54 ? ? 63.59 162.71 163 19 GLU A 5 ? ? -103.43 -76.76 164 19 ARG A 16 ? ? -65.59 96.75 165 19 PRO A 26 ? ? -55.60 95.98 166 19 ALA A 31 ? ? -59.99 88.11 167 19 ARG A 36 ? ? -177.06 -178.20 168 19 ARG A 41 ? ? 76.56 -48.20 169 19 LYS A 51 ? ? -83.50 -86.25 170 19 LYS A 52 ? ? -156.13 71.03 171 20 ALA A 10 ? ? -54.13 106.66 172 20 PRO A 26 ? ? -68.78 76.71 173 20 PHE A 29 ? ? -72.92 -167.06 174 20 ARG A 36 ? ? -173.48 -179.90 175 20 ARG A 41 ? ? 76.09 -44.21 176 20 TYR A 44 ? ? -59.12 104.92 177 20 LYS A 48 ? ? -70.61 20.68 178 20 SER A 53 ? ? 69.80 173.35 # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'Northeast Structural Genomics Consortium' 1 NESG 'PSI, Protein Structure Initiative' 'Ontario Centre for Structural Proteomics' 2 OCSP ? # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K4X _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K4X _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.5 mM [U-100% 13C; U-100% 15N] 30S ribosomal protein S27A, 10 mM [U-100% 2H] TRIS, 300 mM sodium chloride, 10 uM ZnSO4, 10 mM [U-100% 2H] DTT, 0.01 % sodium azide, 10 mM benzamidine, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.5 mM [U-100% 13C; U-100% 15N] 30S ribosomal protein S27A, 10 mM [U-100% 2H] TRIS, 300 mM sodium chloride, 10 uM ZnSO4, 10 mM [U-100% 2H] DTT, 0.01 % sodium azide, 10 mM benzamidine, 100% D2O ; 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id '30S ribosomal protein S27A' 0.5 mM '[U-100% 13C; U-100% 15N]' 1 TRIS 10 mM '[U-100% 2H]' 1 'sodium chloride' 300 mM ? 1 ZnSO4 10 uM ? 1 DTT 10 mM '[U-100% 2H]' 1 'sodium azide' 0.01 % ? 1 benzamidine 10 mM ? 1 '30S ribosomal protein S27A' 0.5 mM '[U-100% 13C; U-100% 15N]' 2 TRIS 10 mM '[U-100% 2H]' 2 'sodium chloride' 300 mM ? 2 ZnSO4 10 uM ? 2 DTT 10 mM '[U-100% 2H]' 2 'sodium azide' 0.01 % ? 2 benzamidine 10 mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 300 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCO' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCACB' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D HNCA' 1 6 1 '3D C(CO)NH' 1 7 1 '3D H(CCO)NH' 1 8 1 '3D HBHA(CO)NH' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D CCH-TOCSY' 1 11 1 '3D 1H-15N NOESY' 1 12 1 '3D 1H-13C NOESY' 1 13 2 '3D 1H-13C NOESY' 1 14 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_refine.entry_id 2K4X _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2.3 1 Goddard 'data analysis' Sparky 3.95 2 Goddard 'peak picking' Sparky 3.95 3 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign ? 4 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.0 6 'Huang, Tejero, Powers and Montelione' 'nmr structure quality assessment' AutoStructure ? 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 ILE N N N N 141 ILE CA C N S 142 ILE C C N N 143 ILE O O N N 144 ILE CB C N S 145 ILE CG1 C N N 146 ILE CG2 C N N 147 ILE CD1 C N N 148 ILE OXT O N N 149 ILE H H N N 150 ILE H2 H N N 151 ILE HA H N N 152 ILE HB H N N 153 ILE HG12 H N N 154 ILE HG13 H N N 155 ILE HG21 H N N 156 ILE HG22 H N N 157 ILE HG23 H N N 158 ILE HD11 H N N 159 ILE HD12 H N N 160 ILE HD13 H N N 161 ILE HXT H N N 162 LEU N N N N 163 LEU CA C N S 164 LEU C C N N 165 LEU O O N N 166 LEU CB C N N 167 LEU CG C N N 168 LEU CD1 C N N 169 LEU CD2 C N N 170 LEU OXT O N N 171 LEU H H N N 172 LEU H2 H N N 173 LEU HA H N N 174 LEU HB2 H N N 175 LEU HB3 H N N 176 LEU HG H N N 177 LEU HD11 H N N 178 LEU HD12 H N N 179 LEU HD13 H N N 180 LEU HD21 H N N 181 LEU HD22 H N N 182 LEU HD23 H N N 183 LEU HXT H N N 184 LYS N N N N 185 LYS CA C N S 186 LYS C C N N 187 LYS O O N N 188 LYS CB C N N 189 LYS CG C N N 190 LYS CD C N N 191 LYS CE C N N 192 LYS NZ N N N 193 LYS OXT O N N 194 LYS H H N N 195 LYS H2 H N N 196 LYS HA H N N 197 LYS HB2 H N N 198 LYS HB3 H N N 199 LYS HG2 H N N 200 LYS HG3 H N N 201 LYS HD2 H N N 202 LYS HD3 H N N 203 LYS HE2 H N N 204 LYS HE3 H N N 205 LYS HZ1 H N N 206 LYS HZ2 H N N 207 LYS HZ3 H N N 208 LYS HXT H N N 209 MET N N N N 210 MET CA C N S 211 MET C C N N 212 MET O O N N 213 MET CB C N N 214 MET CG C N N 215 MET SD S N N 216 MET CE C N N 217 MET OXT O N N 218 MET H H N N 219 MET H2 H N N 220 MET HA H N N 221 MET HB2 H N N 222 MET HB3 H N N 223 MET HG2 H N N 224 MET HG3 H N N 225 MET HE1 H N N 226 MET HE2 H N N 227 MET HE3 H N N 228 MET HXT H N N 229 PHE N N N N 230 PHE CA C N S 231 PHE C C N N 232 PHE O O N N 233 PHE CB C N N 234 PHE CG C Y N 235 PHE CD1 C Y N 236 PHE CD2 C Y N 237 PHE CE1 C Y N 238 PHE CE2 C Y N 239 PHE CZ C Y N 240 PHE OXT O N N 241 PHE H H N N 242 PHE H2 H N N 243 PHE HA H N N 244 PHE HB2 H N N 245 PHE HB3 H N N 246 PHE HD1 H N N 247 PHE HD2 H N N 248 PHE HE1 H N N 249 PHE HE2 H N N 250 PHE HZ H N N 251 PHE HXT H N N 252 PRO N N N N 253 PRO CA C N S 254 PRO C C N N 255 PRO O O N N 256 PRO CB C N N 257 PRO CG C N N 258 PRO CD C N N 259 PRO OXT O N N 260 PRO H H N N 261 PRO HA H N N 262 PRO HB2 H N N 263 PRO HB3 H N N 264 PRO HG2 H N N 265 PRO HG3 H N N 266 PRO HD2 H N N 267 PRO HD3 H N N 268 PRO HXT H N N 269 SER N N N N 270 SER CA C N S 271 SER C C N N 272 SER O O N N 273 SER CB C N N 274 SER OG O N N 275 SER OXT O N N 276 SER H H N N 277 SER H2 H N N 278 SER HA H N N 279 SER HB2 H N N 280 SER HB3 H N N 281 SER HG H N N 282 SER HXT H N N 283 THR N N N N 284 THR CA C N S 285 THR C C N N 286 THR O O N N 287 THR CB C N R 288 THR OG1 O N N 289 THR CG2 C N N 290 THR OXT O N N 291 THR H H N N 292 THR H2 H N N 293 THR HA H N N 294 THR HB H N N 295 THR HG1 H N N 296 THR HG21 H N N 297 THR HG22 H N N 298 THR HG23 H N N 299 THR HXT H N N 300 TYR N N N N 301 TYR CA C N S 302 TYR C C N N 303 TYR O O N N 304 TYR CB C N N 305 TYR CG C Y N 306 TYR CD1 C Y N 307 TYR CD2 C Y N 308 TYR CE1 C Y N 309 TYR CE2 C Y N 310 TYR CZ C Y N 311 TYR OH O N N 312 TYR OXT O N N 313 TYR H H N N 314 TYR H2 H N N 315 TYR HA H N N 316 TYR HB2 H N N 317 TYR HB3 H N N 318 TYR HD1 H N N 319 TYR HD2 H N N 320 TYR HE1 H N N 321 TYR HE2 H N N 322 TYR HH H N N 323 TYR HXT H N N 324 VAL N N N N 325 VAL CA C N S 326 VAL C C N N 327 VAL O O N N 328 VAL CB C N N 329 VAL CG1 C N N 330 VAL CG2 C N N 331 VAL OXT O N N 332 VAL H H N N 333 VAL H2 H N N 334 VAL HA H N N 335 VAL HB H N N 336 VAL HG11 H N N 337 VAL HG12 H N N 338 VAL HG13 H N N 339 VAL HG21 H N N 340 VAL HG22 H N N 341 VAL HG23 H N N 342 VAL HXT H N N 343 ZN ZN ZN N N 344 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 ILE N CA sing N N 134 ILE N H sing N N 135 ILE N H2 sing N N 136 ILE CA C sing N N 137 ILE CA CB sing N N 138 ILE CA HA sing N N 139 ILE C O doub N N 140 ILE C OXT sing N N 141 ILE CB CG1 sing N N 142 ILE CB CG2 sing N N 143 ILE CB HB sing N N 144 ILE CG1 CD1 sing N N 145 ILE CG1 HG12 sing N N 146 ILE CG1 HG13 sing N N 147 ILE CG2 HG21 sing N N 148 ILE CG2 HG22 sing N N 149 ILE CG2 HG23 sing N N 150 ILE CD1 HD11 sing N N 151 ILE CD1 HD12 sing N N 152 ILE CD1 HD13 sing N N 153 ILE OXT HXT sing N N 154 LEU N CA sing N N 155 LEU N H sing N N 156 LEU N H2 sing N N 157 LEU CA C sing N N 158 LEU CA CB sing N N 159 LEU CA HA sing N N 160 LEU C O doub N N 161 LEU C OXT sing N N 162 LEU CB CG sing N N 163 LEU CB HB2 sing N N 164 LEU CB HB3 sing N N 165 LEU CG CD1 sing N N 166 LEU CG CD2 sing N N 167 LEU CG HG sing N N 168 LEU CD1 HD11 sing N N 169 LEU CD1 HD12 sing N N 170 LEU CD1 HD13 sing N N 171 LEU CD2 HD21 sing N N 172 LEU CD2 HD22 sing N N 173 LEU CD2 HD23 sing N N 174 LEU OXT HXT sing N N 175 LYS N CA sing N N 176 LYS N H sing N N 177 LYS N H2 sing N N 178 LYS CA C sing N N 179 LYS CA CB sing N N 180 LYS CA HA sing N N 181 LYS C O doub N N 182 LYS C OXT sing N N 183 LYS CB CG sing N N 184 LYS CB HB2 sing N N 185 LYS CB HB3 sing N N 186 LYS CG CD sing N N 187 LYS CG HG2 sing N N 188 LYS CG HG3 sing N N 189 LYS CD CE sing N N 190 LYS CD HD2 sing N N 191 LYS CD HD3 sing N N 192 LYS CE NZ sing N N 193 LYS CE HE2 sing N N 194 LYS CE HE3 sing N N 195 LYS NZ HZ1 sing N N 196 LYS NZ HZ2 sing N N 197 LYS NZ HZ3 sing N N 198 LYS OXT HXT sing N N 199 MET N CA sing N N 200 MET N H sing N N 201 MET N H2 sing N N 202 MET CA C sing N N 203 MET CA CB sing N N 204 MET CA HA sing N N 205 MET C O doub N N 206 MET C OXT sing N N 207 MET CB CG sing N N 208 MET CB HB2 sing N N 209 MET CB HB3 sing N N 210 MET CG SD sing N N 211 MET CG HG2 sing N N 212 MET CG HG3 sing N N 213 MET SD CE sing N N 214 MET CE HE1 sing N N 215 MET CE HE2 sing N N 216 MET CE HE3 sing N N 217 MET OXT HXT sing N N 218 PHE N CA sing N N 219 PHE N H sing N N 220 PHE N H2 sing N N 221 PHE CA C sing N N 222 PHE CA CB sing N N 223 PHE CA HA sing N N 224 PHE C O doub N N 225 PHE C OXT sing N N 226 PHE CB CG sing N N 227 PHE CB HB2 sing N N 228 PHE CB HB3 sing N N 229 PHE CG CD1 doub Y N 230 PHE CG CD2 sing Y N 231 PHE CD1 CE1 sing Y N 232 PHE CD1 HD1 sing N N 233 PHE CD2 CE2 doub Y N 234 PHE CD2 HD2 sing N N 235 PHE CE1 CZ doub Y N 236 PHE CE1 HE1 sing N N 237 PHE CE2 CZ sing Y N 238 PHE CE2 HE2 sing N N 239 PHE CZ HZ sing N N 240 PHE OXT HXT sing N N 241 PRO N CA sing N N 242 PRO N CD sing N N 243 PRO N H sing N N 244 PRO CA C sing N N 245 PRO CA CB sing N N 246 PRO CA HA sing N N 247 PRO C O doub N N 248 PRO C OXT sing N N 249 PRO CB CG sing N N 250 PRO CB HB2 sing N N 251 PRO CB HB3 sing N N 252 PRO CG CD sing N N 253 PRO CG HG2 sing N N 254 PRO CG HG3 sing N N 255 PRO CD HD2 sing N N 256 PRO CD HD3 sing N N 257 PRO OXT HXT sing N N 258 SER N CA sing N N 259 SER N H sing N N 260 SER N H2 sing N N 261 SER CA C sing N N 262 SER CA CB sing N N 263 SER CA HA sing N N 264 SER C O doub N N 265 SER C OXT sing N N 266 SER CB OG sing N N 267 SER CB HB2 sing N N 268 SER CB HB3 sing N N 269 SER OG HG sing N N 270 SER OXT HXT sing N N 271 THR N CA sing N N 272 THR N H sing N N 273 THR N H2 sing N N 274 THR CA C sing N N 275 THR CA CB sing N N 276 THR CA HA sing N N 277 THR C O doub N N 278 THR C OXT sing N N 279 THR CB OG1 sing N N 280 THR CB CG2 sing N N 281 THR CB HB sing N N 282 THR OG1 HG1 sing N N 283 THR CG2 HG21 sing N N 284 THR CG2 HG22 sing N N 285 THR CG2 HG23 sing N N 286 THR OXT HXT sing N N 287 TYR N CA sing N N 288 TYR N H sing N N 289 TYR N H2 sing N N 290 TYR CA C sing N N 291 TYR CA CB sing N N 292 TYR CA HA sing N N 293 TYR C O doub N N 294 TYR C OXT sing N N 295 TYR CB CG sing N N 296 TYR CB HB2 sing N N 297 TYR CB HB3 sing N N 298 TYR CG CD1 doub Y N 299 TYR CG CD2 sing Y N 300 TYR CD1 CE1 sing Y N 301 TYR CD1 HD1 sing N N 302 TYR CD2 CE2 doub Y N 303 TYR CD2 HD2 sing N N 304 TYR CE1 CZ doub Y N 305 TYR CE1 HE1 sing N N 306 TYR CE2 CZ sing Y N 307 TYR CE2 HE2 sing N N 308 TYR CZ OH sing N N 309 TYR OH HH sing N N 310 TYR OXT HXT sing N N 311 VAL N CA sing N N 312 VAL N H sing N N 313 VAL N H2 sing N N 314 VAL CA C sing N N 315 VAL CA CB sing N N 316 VAL CA HA sing N N 317 VAL C O doub N N 318 VAL C OXT sing N N 319 VAL CB CG1 sing N N 320 VAL CB CG2 sing N N 321 VAL CB HB sing N N 322 VAL CG1 HG11 sing N N 323 VAL CG1 HG12 sing N N 324 VAL CG1 HG13 sing N N 325 VAL CG2 HG21 sing N N 326 VAL CG2 HG22 sing N N 327 VAL CG2 HG23 sing N N 328 VAL OXT HXT sing N N 329 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2K4X _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_