data_2K51 # _entry.id 2K51 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K51 pdb_00002k51 10.2210/pdb2k51/pdb RCSB RCSB100684 ? ? WWPDB D_1000100684 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 15806 BMRB 'Entry containing experimentaL NMR restraints and 1H and 15N chemical shift assignments for the neurotrypsin kringle domain' unspecified 2K4R PDB 'Entry containing the coordinates of ensemble of 29 structures of the neurotrypsin kringle domain' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K51 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-06-23 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Ozhogina, O.A.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'NMR Solution Structure of the Neurotrypsin Kringle Domain' _citation.journal_abbrev Biochemistry _citation.journal_volume 47 _citation.page_first 12290 _citation.page_last 12298 _citation.year 2008 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18956887 _citation.pdbx_database_id_DOI 10.1021/bi800555z # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ozhogina, O.A.' 1 ? primary 'Grishaev, A.' 2 ? primary 'Bominaar, E.L.' 3 ? primary 'Llinas, M.' 4 ? # _cell.entry_id 2K51 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2K51 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Neurotrypsin _entity.formula_weight 8542.461 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.4.21.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'KRINGLE DOMAIN, NT/K, sequence database residues 84-160' _entity.details 'FORMULA MASS: 8533 Da (NATURAL ABUNDANCE), 8635 Da (15N-ENRICHED), EXTINCTION COEFFICIENT (280 nm): 30855 M-1cm-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code RCGAGEPWGNATNLGVPCLHWDEVPPFLERSPPASWAELRGQPHNFCRSPDGAGRPWCFYRNAQGKVDWGYCDCGQG _entity_poly.pdbx_seq_one_letter_code_can RCGAGEPWGNATNLGVPCLHWDEVPPFLERSPPASWAELRGQPHNFCRSPDGAGRPWCFYRNAQGKVDWGYCDCGQG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 CYS n 1 3 GLY n 1 4 ALA n 1 5 GLY n 1 6 GLU n 1 7 PRO n 1 8 TRP n 1 9 GLY n 1 10 ASN n 1 11 ALA n 1 12 THR n 1 13 ASN n 1 14 LEU n 1 15 GLY n 1 16 VAL n 1 17 PRO n 1 18 CYS n 1 19 LEU n 1 20 HIS n 1 21 TRP n 1 22 ASP n 1 23 GLU n 1 24 VAL n 1 25 PRO n 1 26 PRO n 1 27 PHE n 1 28 LEU n 1 29 GLU n 1 30 ARG n 1 31 SER n 1 32 PRO n 1 33 PRO n 1 34 ALA n 1 35 SER n 1 36 TRP n 1 37 ALA n 1 38 GLU n 1 39 LEU n 1 40 ARG n 1 41 GLY n 1 42 GLN n 1 43 PRO n 1 44 HIS n 1 45 ASN n 1 46 PHE n 1 47 CYS n 1 48 ARG n 1 49 SER n 1 50 PRO n 1 51 ASP n 1 52 GLY n 1 53 ALA n 1 54 GLY n 1 55 ARG n 1 56 PRO n 1 57 TRP n 1 58 CYS n 1 59 PHE n 1 60 TYR n 1 61 ARG n 1 62 ASN n 1 63 ALA n 1 64 GLN n 1 65 GLY n 1 66 LYS n 1 67 VAL n 1 68 ASP n 1 69 TRP n 1 70 GLY n 1 71 TYR n 1 72 CYS n 1 73 ASP n 1 74 CYS n 1 75 GLY n 1 76 GLN n 1 77 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Prss12, nt' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain JM-109 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pmed23 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q99JC8_RAT _struct_ref.pdbx_db_accession Q99JC8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RCGAGEPWGNATNLGVPCLHWDEVPPFLERSPPASWAELRGQPHNFCRSPDGAGRPWCFYRNAQGKVDWGYCDCGQG _struct_ref.pdbx_align_begin 84 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K51 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 77 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99JC8 _struct_ref_seq.db_align_beg 84 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 160 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 77 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D 1H-15N HSQC' 1 2 1 '2D [1H-15N]-HMBC' 1 3 1 '2D 1H-13C HSQC' 1 4 1 '2D 1H-1H COSY' 1 5 1 '2D 1H-1H TOCSY' 1 6 1 '2D 1H-1H NOESY' 1 7 1 '3D TOCSY-[1H-15N]-HSQC' 1 8 1 '3D NOESY-[1H-15N]-HSQC' 1 9 1 '3D HNHA' 1 10 1 '3D HNHB' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 5.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'no salt' _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 MM [U-100% 15N] NT/K, 0.02% sodium azide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE DRX' _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2K51 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;THE AUTOMATED NOESY ASSIGNMENT AND STRUCTURE CALCULATIONS CARRIED OUT BY BACUS/CNS. FINAL STRUCTURE REFINEMENT IN AN EXPLICIT SHELL OF WATER WAS PERFORMED USING ARIA/CNS, ON THE BASIS OF FIXED UNAMBIGUOUS DISTANCE RESTRAINTS AND STRUCTURES OBTAINED WITH BACUS/CNS, AND RESTRAINTS ON DIHEDRAL ANGLES AND HYDROGEN BONDS. NOTE THAT RESIDUES 1 - 7 AT THE N-TERMINUS AND RESIDUES 73 - 77 AT THE C-TERMINUS ARE DISORDERED. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2K51 _pdbx_nmr_details.text ;CHEMICAL SHIFT REFERENCE: 1,4-DIOXANE, 3.75 PPM, SPECTRA USED FOR NOESY ASSIGNMENT AND STRUCTURE CALCULATIONS WERE: 2D [1H-1H]-NOESY (MIXING TIME OF 100 MS) AND 3D NOESY-[1H-15N]-HSQC (MIXING TIME OF 200 MS). ; # _pdbx_nmr_ensemble.entry_id 2K51 _pdbx_nmr_ensemble.conformers_calculated_total_number 70 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'STRUCTURE WITH THE LOWEST RMSD TO THE MEAN COORDINATES OF THE ENSEMBLE' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2K51 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'conformer with the lowest rmsd to the mean coordinates of the ensemble' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement ARIA/CNS 2.0 'LINGE, J., NILGES, M., HABECK, M., RIEPING, W.' 1 'structure solution' ARIA/CNS 2.0 'LINGE, J., NILGES, M., HABECK, M., RIEPING, W.' 2 'structure solution' BACUS ? ? 3 'structure solution' CNS 1.1 ? 4 'structure solution' 'CcpNmr Analysis' 1.4 ? 5 # _exptl.entry_id 2K51 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2K51 _struct.title 'NMR Solution Structure of the Neurotrypsin Kringle Domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K51 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'NEUROTRYPSIN, KRINGLE DOMAIN, DISULFIDE-RICH PROTEIN FOLD, SERINE ENDOPEPTIDASE, HYDROLASE, EXTRACELLULAR PROTEOLYSIS' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 17 ? HIS A 20 ? PRO A 17 HIS A 20 4 ? 4 HELX_P HELX_P2 2 VAL A 24 ? PRO A 26 ? VAL A 24 PRO A 26 3 ? 3 HELX_P HELX_P3 3 SER A 31 ? PRO A 33 ? SER A 31 PRO A 33 3 ? 3 HELX_P HELX_P4 4 ALA A 37 ? LEU A 39 ? ALA A 37 LEU A 39 3 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 74 SG ? ? A CYS 2 A CYS 74 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 58 SG ? ? A CYS 18 A CYS 58 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf3 disulf ? ? A CYS 47 SG ? ? ? 1_555 A CYS 72 SG ? ? A CYS 47 A CYS 72 1_555 ? ? ? ? ? ? ? 2.033 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 2 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 10 ? THR A 12 ? ASN A 10 THR A 12 A 2 VAL A 16 ? CYS A 18 ? VAL A 16 CYS A 18 B 1 PRO A 17 ? LEU A 19 ? PRO A 17 LEU A 19 B 2 PHE A 59 ? ARG A 61 ? PHE A 59 ARG A 61 C 1 ARG A 48 ? ARG A 48 ? ARG A 48 ARG A 48 C 2 TRP A 57 ? TRP A 57 ? TRP A 57 TRP A 57 D 1 TRP A 57 ? ASN A 62 ? TRP A 57 ASN A 62 D 2 LYS A 66 ? TYR A 71 ? LYS A 66 TYR A 71 # _atom_sites.entry_id 2K51 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 1 1 ARG ARG A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 TRP 69 69 69 TRP TRP A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 GLY 77 77 77 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-12-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX DETERMINATION METHOD: AUTHOR ; 700 ;SHEET DETERMINATION METHOD: AUTHOR ; # _pdbx_nmr_exptl_sample.component Neurotrypsin _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count 3 _pdbx_nmr_constraints.entry_id 2K51 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 24 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1342 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 613 _pdbx_nmr_constraints.NOE_long_range_total_count 295 _pdbx_nmr_constraints.NOE_medium_range_total_count 119 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 313 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 48 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 40 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 9 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 2 ? ? -156.24 -31.00 2 1 PHE A 46 ? ? 166.02 144.88 3 1 SER A 49 ? ? -161.57 102.09 4 1 ALA A 53 ? ? -154.32 25.93 5 1 ASP A 73 ? ? -129.11 -68.02 6 1 CYS A 74 ? ? 170.04 73.92 #