data_2K5R # _entry.id 2K5R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K5R pdb_00002k5r 10.2210/pdb2k5r/pdb RCSB RCSB100710 ? ? BMRB 15847 ? ? WWPDB D_1000100710 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details XfR39 TargetDB unspecified . 15847 BMRB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K5R _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-06-30 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tang, Y.' 1 'Wang, H.' 2 'Jiang, M.' 3 'Maglaqui, M.' 4 'Xiao, R.' 5 'Liu, J.' 6 'Baran, M.C.' 7 'Swapna, G.' 8 'Acton, T.B.' 9 'Rost, B.' 10 'Montelione, G.T.' 11 'Northeast Structural Genomics Consortium (NESG)' 12 # _citation.id primary _citation.title ;Solution NMR Structure of XF2673 from Xylella fastidiosa. Northeast Structural Genomics Consortium Target XfR39 ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tang, Y.' 1 ? primary 'Wang, H.' 2 ? primary 'Jiang, M.' 3 ? primary 'Maglaqui, M.' 4 ? primary 'Xiao, R.' 5 ? primary 'Liu, J.' 6 ? primary 'Baran, M.C.' 7 ? primary 'Swapna, G.' 8 ? primary 'Acton, T.B.' 9 ? primary 'Rost, B.' 10 ? primary 'Montelione, G.T.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'uncharacterized protein XF2673' _entity.formula_weight 11000.567 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'residue 90-97 represent a non-native purification tag (LEHHHHHH)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDRKLLHLLCSPDTRQPLSLLESKGLEALNKAIVSGTVQRADGSIQNQSLHEALITRDRKQVFRIEDSIPVLLPEEAIAT IQIANFPDKLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDRKLLHLLCSPDTRQPLSLLESKGLEALNKAIVSGTVQRADGSIQNQSLHEALITRDRKQVFRIEDSIPVLLPEEAIAT IQIANFPDKLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier XfR39 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ARG n 1 4 LYS n 1 5 LEU n 1 6 LEU n 1 7 HIS n 1 8 LEU n 1 9 LEU n 1 10 CYS n 1 11 SER n 1 12 PRO n 1 13 ASP n 1 14 THR n 1 15 ARG n 1 16 GLN n 1 17 PRO n 1 18 LEU n 1 19 SER n 1 20 LEU n 1 21 LEU n 1 22 GLU n 1 23 SER n 1 24 LYS n 1 25 GLY n 1 26 LEU n 1 27 GLU n 1 28 ALA n 1 29 LEU n 1 30 ASN n 1 31 LYS n 1 32 ALA n 1 33 ILE n 1 34 VAL n 1 35 SER n 1 36 GLY n 1 37 THR n 1 38 VAL n 1 39 GLN n 1 40 ARG n 1 41 ALA n 1 42 ASP n 1 43 GLY n 1 44 SER n 1 45 ILE n 1 46 GLN n 1 47 ASN n 1 48 GLN n 1 49 SER n 1 50 LEU n 1 51 HIS n 1 52 GLU n 1 53 ALA n 1 54 LEU n 1 55 ILE n 1 56 THR n 1 57 ARG n 1 58 ASP n 1 59 ARG n 1 60 LYS n 1 61 GLN n 1 62 VAL n 1 63 PHE n 1 64 ARG n 1 65 ILE n 1 66 GLU n 1 67 ASP n 1 68 SER n 1 69 ILE n 1 70 PRO n 1 71 VAL n 1 72 LEU n 1 73 LEU n 1 74 PRO n 1 75 GLU n 1 76 GLU n 1 77 ALA n 1 78 ILE n 1 79 ALA n 1 80 THR n 1 81 ILE n 1 82 GLN n 1 83 ILE n 1 84 ALA n 1 85 ASN n 1 86 PHE n 1 87 PRO n 1 88 ASP n 1 89 LYS n 1 90 LEU n 1 91 GLU n 1 92 HIS n 1 93 HIS n 1 94 HIS n 1 95 HIS n 1 96 HIS n 1 97 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Xylella _entity_src_gen.pdbx_gene_src_gene PD_2037 _entity_src_gen.gene_src_species fastidiosa _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Xylella fastidiosa Temecula1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 183190 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name XfR39-21.3 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'C-terminal tag LEHHHHHH. The protein is a monomer by gel filtration chromatography and static light scattering' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q87A02_XYLFT _struct_ref.pdbx_db_accession Q87A02 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDRKLLHLLCSPDTRQPLSLLESKGLEALNKAIVSGTVQRADGSIQNQSLHEALITRDRKQVFRIEDSIPVLLPEEAIAT IQIANFPDK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K5R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q87A02 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 89 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 89 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K5R LEU A 90 ? UNP Q87A02 ? ? 'expression tag' 90 1 1 2K5R GLU A 91 ? UNP Q87A02 ? ? 'expression tag' 91 2 1 2K5R HIS A 92 ? UNP Q87A02 ? ? 'expression tag' 92 3 1 2K5R HIS A 93 ? UNP Q87A02 ? ? 'expression tag' 93 4 1 2K5R HIS A 94 ? UNP Q87A02 ? ? 'expression tag' 94 5 1 2K5R HIS A 95 ? UNP Q87A02 ? ? 'expression tag' 95 6 1 2K5R HIS A 96 ? UNP Q87A02 ? ? 'expression tag' 96 7 1 2K5R HIS A 97 ? UNP Q87A02 ? ? 'expression tag' 97 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '2D 1H-13C HSQC_armatic' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HBHA(CO)NH' 1 6 1 '3D HNCACB' 1 7 1 '3D HCCH-TOCSY' 1 8 1 '3D HCCH-COSY' 1 9 1 '3D CCH-TOCSY' 1 10 1 '3D HNCO' 1 11 1 '3D 1H-15N NOESY' 1 12 1 '3D simutaeous NOESY' 1 13 1 '3D 1H-13C NOESY aromatic' 1 14 2 '2D 1H-13C HSQC_high resolution' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.0 mM [U-100% 13C; U-100% 15N] XfR39, 20 mM MES, 100 mM NaCl, 5 mM CaCl2, 10 mM DTT, 0.02 % NaN3, 50 uM DSS, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '1.0 mM [U-5% 13C; U-100% 15N] XfR39, 20 mM MES, 100 mM NaCl, 5 mM CaCl2, 10 mM DTT, 0.02 % NaN3, 50 uM DSS, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2K5R _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;THE STRUCTURES ARE BASED ON A TOTAL OF 1591 COMFORMATIONALLY-RESTRICTING NOE-DERIVED DISTANCE CONSTRAINTS, 100 DIHEDRAL ANGLE CONSTRAINTS, AND 42 HYDROGEN BOND CONSTRAINTS (18.8 CONSTRAINTS PER RESIDUE, 4.4 LONG RANGE CONSTRAINTS PER RESIDUE, COMPUTED FOR RESIDUES 1 TO 97 BY PSVS 1.3) STRUCTURE DETERMINATION WAS PERFORMED ITERATIVELY USING AUTOSTRUCTURE AND CYANA. THE 20 LOWEST ENERGY STRUCTURES OUT OF 100 WERE FURTHER REFINED BY RESTRAINED MOLECULAR DYNAMICS/ENERGY MINIMIZATION IN EXPLICIT WATER (CNS). THE C-TERMINAL HIS TAG RESIDUES OF THE PROTEIN (HHHHHH) WERE INCLUDED IN ALL STRUCTURE CALCULATIONS AND HAVE BEEN INCLUDED IN THIS DEPOSITION. COORDINATES FOR THE FOLLOWING RESIDUES ARE NOT WELL DETERMINED: 1-17, 67-68, 88-97. THE STRUCTURE WAS DETERMINED USING TRIPLE RESONANCE NMR SPECTROSCOPY. AUTOMATED BACKBONE ASSIGNMENTS WERE MADE USING AUTOASSIGN AND THE SIDE CHAIN ASSIGNMENTS WERE COMPLETED MANUALLY. AUTOMATIC NOESY ASSIGNMENTS AS WELL AS DISTANCE, DIHEDRAL ANGLE (TALOS) AND HYDROGEN BOND CONSTRAINTS WERE DETERMINED USING CYANA. COMPLETENESS OF NMR ASSIGNMENT: BACKBONE, 91.81%, SIDE CHAIN, 80.87%, AROMATICS, 60.00%, STEREOSPECIFIC METHYL, 82.35%, FINAL STRUCTURE QUALITY FACTORS (FOR RESIDUE 1-97 PSVS 1.3), WHERE ORDERED RESIDUE RANGES COMPRISE: 18-66, 69-87. (A) RMSD (ORDERED RESIDUES): BB 0.82, HEAVY ATOM: 1.46 (B) RAMACHANDRAN STATISTICS FOR ORDERED RESIDUES: MOST FAVORED, 92.8%, ADDITIONALLY ALLOWED: 7.2%, GENEROUSLY ALLOWED : 0.0%, DISALLOWED, 0.0%. (C) PROCHECK SCORES FOR ORDERED RESIDUES (RAW/Z): PHI-PSI, -0.30/-0.87, ALL , -0.26/-1.54. (D) MOLPROBITY CLASH SCORE (RAW/Z): 16.58/-1.32. (E) RPF SCORES FOR GOODNESS OF FIT TO NOESY DATA (RESIDUE 1-97): RECALL, 1, PRECISION, 0.979, F-MEASURE, 0.99, DP-SCORE, 0.823. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K5R _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 4.6 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.25 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K5R _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 2.1 1 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.2.1 2 Goddard 'peak picking' Sparky 3.110 3 Goddard 'data analysis' Sparky 3.110 4 'Huang, Tejero, Powers and Montelione' 'structure solution' AutoStructure 2.2.1 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 6 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2.3 7 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.1 8 'Bhattacharya and Montelione' 'data analysis' PSVS 1.3 9 'Tejero and Montelione' pdbanalysis PdbStat 5.0 10 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K5R _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K5R _struct.title 'Solution NMR Structure of XF2673 from Xylella fastidiosa. Northeast Structural Genomics Consortium Target XfR39' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag Y _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K5R _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text ;solution NMR structure, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, unknown function ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 22 ? GLY A 36 ? GLU A 22 GLY A 36 1 ? 15 HELX_P HELX_P2 2 LEU A 73 ? GLU A 75 ? LEU A 73 GLU A 75 5 ? 3 HELX_P HELX_P3 3 ILE A 81 ? ILE A 83 ? ILE A 81 ILE A 83 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 19 ? LEU A 20 ? SER A 19 LEU A 20 A 2 GLU A 52 ? ILE A 55 ? GLU A 52 ILE A 55 A 3 GLN A 61 ? GLU A 66 ? GLN A 61 GLU A 66 A 4 ILE A 69 ? VAL A 71 ? ILE A 69 VAL A 71 B 1 SER A 19 ? LEU A 20 ? SER A 19 LEU A 20 B 2 GLU A 52 ? ILE A 55 ? GLU A 52 ILE A 55 B 3 GLN A 61 ? GLU A 66 ? GLN A 61 GLU A 66 B 4 ALA A 77 ? ALA A 79 ? ALA A 77 ALA A 79 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 19 ? N SER A 19 O ILE A 55 ? O ILE A 55 A 2 3 N LEU A 54 ? N LEU A 54 O PHE A 63 ? O PHE A 63 A 3 4 N GLU A 66 ? N GLU A 66 O ILE A 69 ? O ILE A 69 B 1 2 N SER A 19 ? N SER A 19 O ILE A 55 ? O ILE A 55 B 2 3 N LEU A 54 ? N LEU A 54 O PHE A 63 ? O PHE A 63 B 3 4 N VAL A 62 ? N VAL A 62 O ILE A 78 ? O ILE A 78 # _atom_sites.entry_id 2K5R _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 HIS 97 97 97 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-08-26 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.01 _pdbx_nmr_ensemble_rms.distance_rms_dev_error ? _pdbx_nmr_ensemble_rms.entry_id 2K5R _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id XfR39 1.0 mM '[U-100% 13C; U-100% 15N]' 1 MES 20 mM ? 1 NaCl 100 mM ? 1 CaCl2 5 mM ? 1 DTT 10 mM ? 1 NaN3 0.02 % ? 1 DSS 50 uM ? 1 XfR39 1.0 mM '[U-5% 13C; U-100% 15N]' 2 MES 20 mM ? 2 NaCl 100 mM ? 2 CaCl2 5 mM ? 2 DTT 10 mM ? 2 NaN3 0.02 % ? 2 DSS 50 uM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2K5R _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total ? _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 50 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 50 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 12 ? ? -68.51 63.93 2 1 PRO A 17 ? ? -56.37 107.01 3 1 ASP A 67 ? ? 72.34 -49.69 4 1 SER A 68 ? ? 166.02 -20.59 5 2 PRO A 17 ? ? -67.75 -167.53 6 2 ASP A 67 ? ? 58.97 -87.10 7 2 SER A 68 ? ? -147.11 10.87 8 2 ASP A 88 ? ? -54.14 107.46 9 3 ASP A 2 ? ? -81.09 40.00 10 3 LEU A 5 ? ? -80.74 -71.83 11 3 LEU A 6 ? ? 64.20 -15.50 12 3 HIS A 94 ? ? -52.67 106.72 13 4 ARG A 15 ? ? 59.75 86.59 14 4 PRO A 17 ? ? -33.57 110.87 15 4 LEU A 72 ? ? -81.78 31.42 16 4 HIS A 92 ? ? -153.69 -12.31 17 4 HIS A 94 ? ? -66.69 88.31 18 4 HIS A 95 ? ? -76.12 33.96 19 4 HIS A 96 ? ? -152.40 40.91 20 5 ARG A 15 ? ? 60.45 80.51 21 5 ASP A 67 ? ? 59.98 -81.39 22 5 ASP A 88 ? ? -155.25 -152.91 23 5 LYS A 89 ? ? -68.62 -176.44 24 5 LEU A 90 ? ? -76.43 44.95 25 6 PRO A 87 ? ? -68.47 90.81 26 6 HIS A 95 ? ? 72.22 -32.97 27 7 ILE A 83 ? ? -69.18 97.66 28 7 ALA A 84 ? ? -66.17 4.69 29 9 LEU A 6 ? ? -67.64 79.69 30 9 PRO A 12 ? ? -68.18 88.21 31 9 ASP A 67 ? ? 62.50 -79.84 32 9 SER A 68 ? ? -158.71 12.97 33 10 PRO A 12 ? ? -75.54 39.10 34 10 ASP A 88 ? ? -79.09 25.14 35 11 ASP A 67 ? ? 61.36 -78.64 36 11 SER A 68 ? ? -169.61 23.56 37 11 PRO A 70 ? ? -65.07 90.26 38 11 PRO A 87 ? ? -49.45 105.02 39 11 LYS A 89 ? ? 73.09 -32.81 40 11 GLU A 91 ? ? 63.71 -87.77 41 11 HIS A 92 ? ? 32.82 48.19 42 11 HIS A 93 ? ? -69.25 94.19 43 12 PRO A 12 ? ? -63.38 95.03 44 12 PRO A 17 ? ? -52.96 107.59 45 12 PRO A 70 ? ? -64.62 90.51 46 12 ALA A 84 ? ? -68.65 6.84 47 13 HIS A 7 ? ? -68.08 3.14 48 13 PRO A 12 ? ? -62.04 -172.01 49 13 LEU A 72 ? ? -91.02 31.19 50 13 ASP A 88 ? ? -71.29 -157.96 51 13 HIS A 95 ? ? -169.72 102.82 52 14 ASP A 2 ? ? -87.56 30.52 53 14 LEU A 8 ? ? -99.90 -83.59 54 14 ARG A 15 ? ? -119.47 76.42 55 14 GLU A 91 ? ? -66.18 85.66 56 15 LEU A 5 ? ? -90.54 -72.00 57 15 LEU A 72 ? ? -104.04 65.56 58 15 HIS A 94 ? ? 63.09 -73.83 59 16 LEU A 8 ? ? -32.48 114.85 60 16 THR A 37 ? ? -148.72 53.72 61 17 ARG A 3 ? ? -107.45 -60.79 62 17 LEU A 8 ? ? 59.58 16.24 63 17 PRO A 17 ? ? -49.34 99.83 64 17 LYS A 89 ? ? -89.45 33.64 65 17 HIS A 95 ? ? -165.35 118.71 66 18 ALA A 84 ? ? -65.70 1.53 67 18 PRO A 87 ? ? -65.85 90.18 68 18 HIS A 92 ? ? -166.18 72.63 69 18 HIS A 95 ? ? 71.62 96.42 70 19 LEU A 6 ? ? -84.38 36.33 71 19 ARG A 15 ? ? -102.68 63.00 72 19 ASP A 67 ? ? 62.22 -78.55 73 19 PRO A 70 ? ? -69.15 97.41 74 19 HIS A 94 ? ? -59.23 87.87 75 20 ASP A 2 ? ? -79.15 43.69 76 20 LEU A 6 ? ? -66.67 3.68 77 20 ASP A 67 ? ? 71.48 -50.68 78 20 SER A 68 ? ? 173.64 -24.15 79 20 HIS A 95 ? ? 72.44 -28.84 #