data_2K6X
# 
_entry.id   2K6X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2K6X         pdb_00002k6x 10.2210/pdb2k6x/pdb 
RCSB  RCSB100752   ?            ?                   
WWPDB D_1000100752 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-10-28 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2021-10-20 
4 'Structure model' 1 3 2024-05-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Data collection'           
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
5 4 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_2            
2 3 'Structure model' pdbx_nmr_spectrometer 
3 3 'Structure model' pdbx_struct_assembly  
4 3 'Structure model' pdbx_struct_oper_list 
5 3 'Structure model' struct_ref_seq_dif    
6 4 'Structure model' chem_comp_atom        
7 4 'Structure model' chem_comp_bond        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_database_2.pdbx_DOI'                
2 3 'Structure model' '_database_2.pdbx_database_accession' 
3 3 'Structure model' '_pdbx_nmr_spectrometer.model'        
4 3 'Structure model' '_struct_ref_seq_dif.details'         
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2K6X 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-07-28 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schwartz, E.C.' 1 
'Shekhtman, A.'  2 
'Dutta, K.'      3 
'Pratt, M.R.'    4 
'Cowburn, D.'    5 
'Darst, S.'      6 
'Muir, T.W.'     7 
# 
_citation.id                        primary 
_citation.title                     
'Autoregulation of a Group 1 Bacterial Sigma Factor Involves the Formation of a Region 1.1 - Induced Compacted Structure' 
_citation.journal_abbrev            Chem.Biol. 
_citation.journal_volume            15 
_citation.page_first                1091 
_citation.page_last                 1103 
_citation.year                      2008 
_citation.journal_id_ASTM           CBOLE2 
_citation.country                   UK 
_citation.journal_id_ISSN           1074-5521 
_citation.journal_id_CSD            2050 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Schwartz, E.C.' 1 ? 
primary 'Shekhtman, A.'  2 ? 
primary 'Dutta, K.'      3 ? 
primary 'Pratt, M.R.'    4 ? 
primary 'Cowburn, D.'    5 ? 
primary 'Darst, S.'      6 ? 
primary 'Muir, T.W.'     7 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'RNA polymerase sigma factor rpoD' 
_entity.formula_weight             8336.333 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              S96G 
_entity.pdbx_fragment              'UNP residues 29-96' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Sigma-A 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSHMPQIERRIKKLISLGKKKGYITYEDIDKAFPPDFEGFDTNLIERIHEELEKHGINIVENEPEEEEISAG 
_entity_poly.pdbx_seq_one_letter_code_can   GSHMPQIERRIKKLISLGKKKGYITYEDIDKAFPPDFEGFDTNLIERIHEELEKHGINIVENEPEEEEISAG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  HIS n 
1 4  MET n 
1 5  PRO n 
1 6  GLN n 
1 7  ILE n 
1 8  GLU n 
1 9  ARG n 
1 10 ARG n 
1 11 ILE n 
1 12 LYS n 
1 13 LYS n 
1 14 LEU n 
1 15 ILE n 
1 16 SER n 
1 17 LEU n 
1 18 GLY n 
1 19 LYS n 
1 20 LYS n 
1 21 LYS n 
1 22 GLY n 
1 23 TYR n 
1 24 ILE n 
1 25 THR n 
1 26 TYR n 
1 27 GLU n 
1 28 ASP n 
1 29 ILE n 
1 30 ASP n 
1 31 LYS n 
1 32 ALA n 
1 33 PHE n 
1 34 PRO n 
1 35 PRO n 
1 36 ASP n 
1 37 PHE n 
1 38 GLU n 
1 39 GLY n 
1 40 PHE n 
1 41 ASP n 
1 42 THR n 
1 43 ASN n 
1 44 LEU n 
1 45 ILE n 
1 46 GLU n 
1 47 ARG n 
1 48 ILE n 
1 49 HIS n 
1 50 GLU n 
1 51 GLU n 
1 52 LEU n 
1 53 GLU n 
1 54 LYS n 
1 55 HIS n 
1 56 GLY n 
1 57 ILE n 
1 58 ASN n 
1 59 ILE n 
1 60 VAL n 
1 61 GLU n 
1 62 ASN n 
1 63 GLU n 
1 64 PRO n 
1 65 GLU n 
1 66 GLU n 
1 67 GLU n 
1 68 GLU n 
1 69 ILE n 
1 70 SER n 
1 71 ALA n 
1 72 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'rpoD, sigA, TM_1451' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermotoga maritima' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2336 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pTXB1 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  25 25 GLY GLY A . n 
A 1 2  SER 2  26 26 SER SER A . n 
A 1 3  HIS 3  27 27 HIS HIS A . n 
A 1 4  MET 4  28 28 MET MET A . n 
A 1 5  PRO 5  29 29 PRO PRO A . n 
A 1 6  GLN 6  30 30 GLN GLN A . n 
A 1 7  ILE 7  31 31 ILE ILE A . n 
A 1 8  GLU 8  32 32 GLU GLU A . n 
A 1 9  ARG 9  33 33 ARG ARG A . n 
A 1 10 ARG 10 34 34 ARG ARG A . n 
A 1 11 ILE 11 35 35 ILE ILE A . n 
A 1 12 LYS 12 36 36 LYS LYS A . n 
A 1 13 LYS 13 37 37 LYS LYS A . n 
A 1 14 LEU 14 38 38 LEU LEU A . n 
A 1 15 ILE 15 39 39 ILE ILE A . n 
A 1 16 SER 16 40 40 SER SER A . n 
A 1 17 LEU 17 41 41 LEU LEU A . n 
A 1 18 GLY 18 42 42 GLY GLY A . n 
A 1 19 LYS 19 43 43 LYS LYS A . n 
A 1 20 LYS 20 44 44 LYS LYS A . n 
A 1 21 LYS 21 45 45 LYS LYS A . n 
A 1 22 GLY 22 46 46 GLY GLY A . n 
A 1 23 TYR 23 47 47 TYR TYR A . n 
A 1 24 ILE 24 48 48 ILE ILE A . n 
A 1 25 THR 25 49 49 THR THR A . n 
A 1 26 TYR 26 50 50 TYR TYR A . n 
A 1 27 GLU 27 51 51 GLU GLU A . n 
A 1 28 ASP 28 52 52 ASP ASP A . n 
A 1 29 ILE 29 53 53 ILE ILE A . n 
A 1 30 ASP 30 54 54 ASP ASP A . n 
A 1 31 LYS 31 55 55 LYS LYS A . n 
A 1 32 ALA 32 56 56 ALA ALA A . n 
A 1 33 PHE 33 57 57 PHE PHE A . n 
A 1 34 PRO 34 58 58 PRO PRO A . n 
A 1 35 PRO 35 59 59 PRO PRO A . n 
A 1 36 ASP 36 60 60 ASP ASP A . n 
A 1 37 PHE 37 61 61 PHE PHE A . n 
A 1 38 GLU 38 62 62 GLU GLU A . n 
A 1 39 GLY 39 63 63 GLY GLY A . n 
A 1 40 PHE 40 64 64 PHE PHE A . n 
A 1 41 ASP 41 65 65 ASP ASP A . n 
A 1 42 THR 42 66 66 THR THR A . n 
A 1 43 ASN 43 67 67 ASN ASN A . n 
A 1 44 LEU 44 68 68 LEU LEU A . n 
A 1 45 ILE 45 69 69 ILE ILE A . n 
A 1 46 GLU 46 70 70 GLU GLU A . n 
A 1 47 ARG 47 71 71 ARG ARG A . n 
A 1 48 ILE 48 72 72 ILE ILE A . n 
A 1 49 HIS 49 73 73 HIS HIS A . n 
A 1 50 GLU 50 74 74 GLU GLU A . n 
A 1 51 GLU 51 75 75 GLU GLU A . n 
A 1 52 LEU 52 76 76 LEU LEU A . n 
A 1 53 GLU 53 77 77 GLU GLU A . n 
A 1 54 LYS 54 78 78 LYS LYS A . n 
A 1 55 HIS 55 79 79 HIS HIS A . n 
A 1 56 GLY 56 80 80 GLY GLY A . n 
A 1 57 ILE 57 81 81 ILE ILE A . n 
A 1 58 ASN 58 82 82 ASN ASN A . n 
A 1 59 ILE 59 83 83 ILE ILE A . n 
A 1 60 VAL 60 84 84 VAL VAL A . n 
A 1 61 GLU 61 85 85 GLU GLU A . n 
A 1 62 ASN 62 86 86 ASN ASN A . n 
A 1 63 GLU 63 87 87 GLU GLU A . n 
A 1 64 PRO 64 88 88 PRO PRO A . n 
A 1 65 GLU 65 89 89 GLU GLU A . n 
A 1 66 GLU 66 90 90 GLU GLU A . n 
A 1 67 GLU 67 91 91 GLU GLU A . n 
A 1 68 GLU 68 92 92 GLU GLU A . n 
A 1 69 ILE 69 93 93 ILE ILE A . n 
A 1 70 SER 70 94 94 SER SER A . n 
A 1 71 ALA 71 95 95 ALA ALA A . n 
A 1 72 GLY 72 96 96 GLY GLY A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2K6X 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2K6X 
_struct.title                     
'Autoregulation of a Group 1 Bacterial Sigma Factor Involves the Formation of a Region 1.1- Induced Compacted Structure' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2K6X 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'sigma 1.1, DNA-binding, Sigma factor, Transcription, Transcription regulation' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RPOD_THEMA 
_struct_ref.pdbx_db_accession          P77994 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   PQIERRIKKLISLGKKKGYITYEDIDKAFPPDFEGFDTNLIERIHEELEKHGINIVENEPEEEEISAS 
_struct_ref.pdbx_align_begin           29 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2K6X 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 5 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 72 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P77994 
_struct_ref_seq.db_align_beg                  29 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  96 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       29 
_struct_ref_seq.pdbx_auth_seq_align_end       96 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2K6X GLY A 1  ? UNP P77994 ?   ?  'expression tag'      25 1 
1 2K6X SER A 2  ? UNP P77994 ?   ?  'expression tag'      26 2 
1 2K6X HIS A 3  ? UNP P77994 ?   ?  'expression tag'      27 3 
1 2K6X MET A 4  ? UNP P77994 ?   ?  'expression tag'      28 4 
1 2K6X GLY A 72 ? UNP P77994 SER 96 'engineered mutation' 96 5 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 MET A 4  ? GLY A 22 ? MET A 28 GLY A 46 1 ? 19 
HELX_P HELX_P2 2 THR A 25 ? PHE A 33 ? THR A 49 PHE A 57 1 ? 9  
HELX_P HELX_P3 3 ASP A 41 ? LYS A 54 ? ASP A 65 LYS A 78 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 1  1.41  
2  PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 2  0.85  
3  PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 3  -1.13 
4  PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 4  1.41  
5  PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 5  -1.78 
6  PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 6  -2.03 
7  PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 7  3.37  
8  PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 8  0.13  
9  PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 9  -0.62 
10 PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 10 -0.22 
11 PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 11 -3.92 
12 PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 12 0.61  
13 PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 13 -1.09 
14 PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 14 0.02  
15 PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 15 0.97  
16 PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 16 -2.39 
17 PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 17 0.14  
18 PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 18 0.76  
19 PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 19 1.08  
20 PHE 33 A . ? PHE 57 A PRO 34 A ? PRO 58 A 20 1.92  
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  HZ3  A LYS 36 ? ? OE2  A GLU 75 ? ? 1.57 
2  1  HE2  A HIS 73 ? ? OE2  A GLU 85 ? ? 1.60 
3  1  OE1  A GLU 75 ? ? HZ3  A LYS 78 ? ? 1.60 
4  2  HZ1  A LYS 36 ? ? OE1  A GLU 75 ? ? 1.59 
5  3  HA   A LEU 76 ? ? HG23 A ILE 81 ? ? 1.25 
6  3  HD2  A ARG 34 ? ? HA   A PHE 61 ? ? 1.33 
7  3  OE1  A GLU 75 ? ? HD1  A HIS 79 ? ? 1.53 
8  3  OE2  A GLU 75 ? ? HZ2  A LYS 78 ? ? 1.59 
9  4  HZ3  A LYS 36 ? ? OE1  A GLU 75 ? ? 1.56 
10 4  OE1  A GLU 77 ? ? HZ1  A LYS 78 ? ? 1.58 
11 5  HE3  A LYS 45 ? ? HA   A ALA 56 ? ? 1.24 
12 5  HH21 A ARG 33 ? ? OE1  A GLU 62 ? ? 1.57 
13 6  HB   A THR 49 ? ? HG11 A VAL 84 ? ? 1.06 
14 6  HZ3  A LYS 36 ? ? OE1  A GLU 75 ? ? 1.55 
15 6  O    A ILE 48 ? ? H    A VAL 84 ? ? 1.57 
16 7  HZ1  A LYS 45 ? ? HA   A ALA 56 ? ? 1.24 
17 7  HZ1  A LYS 36 ? ? OE1  A GLU 75 ? ? 1.60 
18 8  HA   A ASP 52 ? ? HD2  A LYS 55 ? ? 1.29 
19 9  HZ1  A LYS 37 ? ? OD1  A ASP 60 ? ? 1.59 
20 10 H    A THR 49 ? ? OD2  A ASP 52 ? ? 1.55 
21 11 HD11 A ILE 39 ? ? HB   A ILE 83 ? ? 1.25 
22 11 HD1  A PHE 57 ? ? HD3  A PRO 59 ? ? 1.33 
23 11 OE2  A GLU 75 ? ? HZ1  A LYS 78 ? ? 1.52 
24 11 HZ3  A LYS 37 ? ? OD1  A ASP 60 ? ? 1.60 
25 11 HH21 A ARG 71 ? ? OE1  A GLU 74 ? ? 1.60 
26 12 HE2  A LYS 45 ? ? HA   A ALA 56 ? ? 1.29 
27 13 OE2  A GLU 32 ? ? HZ3  A LYS 36 ? ? 1.57 
28 14 HZ2  A LYS 36 ? ? OE2  A GLU 75 ? ? 1.57 
29 15 HZ1  A LYS 36 ? ? OE1  A GLU 75 ? ? 1.54 
30 16 HA   A LEU 41 ? ? HE2  A LYS 44 ? ? 1.29 
31 16 HZ1  A LYS 36 ? ? OE1  A GLU 75 ? ? 1.56 
32 17 HZ2  A LYS 36 ? ? OE1  A GLU 75 ? ? 1.56 
33 18 HB   A THR 49 ? ? HG11 A VAL 84 ? ? 1.15 
34 18 O    A ILE 48 ? ? H    A VAL 84 ? ? 1.51 
35 19 HA   A LEU 76 ? ? HG22 A ILE 81 ? ? 1.32 
36 20 OE1  A GLU 75 ? ? HD1  A HIS 79 ? ? 1.60 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  SER A 26 ? ? -129.50 -160.15 
2  1  ASN A 86 ? ? 77.57   -12.49  
3  1  GLU A 92 ? ? -139.80 -80.88  
4  2  MET A 28 ? ? -172.08 77.27   
5  2  SER A 94 ? ? 71.83   -53.31  
6  3  PRO A 59 ? ? -98.61  -158.83 
7  3  ALA A 95 ? ? -146.38 32.61   
8  4  GLU A 92 ? ? -177.35 -71.83  
9  5  MET A 28 ? ? -154.27 74.47   
10 5  GLU A 89 ? ? 71.04   -62.06  
11 5  GLU A 91 ? ? 73.09   162.94  
12 5  GLU A 92 ? ? -170.36 -49.27  
13 5  SER A 94 ? ? 64.93   61.95   
14 5  ALA A 95 ? ? -162.77 -57.85  
15 6  PRO A 59 ? ? -105.53 -139.63 
16 6  GLU A 91 ? ? 64.86   -97.15  
17 6  GLU A 92 ? ? -147.46 -68.49  
18 7  PRO A 59 ? ? -100.29 -150.88 
19 7  ASN A 86 ? ? 81.75   -4.07   
20 7  GLU A 92 ? ? -146.83 -59.61  
21 8  PRO A 59 ? ? -100.93 -156.78 
22 8  GLU A 92 ? ? -134.45 -64.81  
23 9  MET A 28 ? ? -128.07 -64.33  
24 9  GLU A 92 ? ? 179.64  86.14   
25 10 SER A 26 ? ? -99.49  39.21   
26 10 HIS A 27 ? ? 71.49   -59.70  
27 10 PRO A 88 ? ? -54.91  105.14  
28 10 GLU A 89 ? ? -88.44  38.42   
29 10 GLU A 92 ? ? -75.53  -71.39  
30 10 SER A 94 ? ? 74.28   -49.78  
31 11 PRO A 59 ? ? -106.60 -108.08 
32 11 ASN A 86 ? ? 76.81   -11.16  
33 11 GLU A 91 ? ? -107.02 80.00   
34 11 GLU A 92 ? ? -98.76  -78.37  
35 11 SER A 94 ? ? 63.29   -82.27  
36 11 ALA A 95 ? ? -139.03 -43.98  
37 12 MET A 28 ? ? -169.24 99.10   
38 12 PRO A 59 ? ? -104.40 -157.47 
39 12 GLU A 92 ? ? -152.03 -59.70  
40 13 PRO A 59 ? ? -103.87 -156.72 
41 13 ASN A 86 ? ? 80.56   -12.17  
42 13 GLU A 90 ? ? 67.31   -148.30 
43 13 GLU A 92 ? ? -172.02 -72.30  
44 13 SER A 94 ? ? 60.36   60.73   
45 14 HIS A 27 ? ? -142.62 -65.27  
46 14 PRO A 59 ? ? -101.51 -157.51 
47 14 ILE A 83 ? ? -173.50 131.92  
48 14 ASN A 86 ? ? 83.44   -11.59  
49 14 GLU A 92 ? ? -105.40 -81.45  
50 15 PRO A 59 ? ? -102.43 -160.16 
51 15 ASN A 86 ? ? 72.71   -0.73   
52 15 GLU A 89 ? ? -177.71 -47.87  
53 15 GLU A 90 ? ? -150.78 30.06   
54 15 ALA A 95 ? ? -104.11 45.75   
55 16 HIS A 27 ? ? 71.67   -59.14  
56 16 MET A 28 ? ? -170.32 130.67  
57 16 ASN A 86 ? ? 73.21   -4.97   
58 16 PRO A 88 ? ? -49.72  -75.33  
59 16 GLU A 89 ? ? -166.58 17.31   
60 16 GLU A 92 ? ? 177.15  -46.00  
61 16 SER A 94 ? ? 60.99   -88.23  
62 17 SER A 26 ? ? 61.90   80.03   
63 17 PRO A 59 ? ? -102.81 -152.15 
64 17 GLU A 90 ? ? 55.65   92.90   
65 17 GLU A 92 ? ? -113.95 -71.07  
66 17 SER A 94 ? ? 69.50   -70.12  
67 18 PRO A 59 ? ? -105.61 -158.11 
68 18 GLU A 91 ? ? -145.74 -66.90  
69 18 GLU A 92 ? ? -153.46 46.15   
70 19 ILE A 83 ? ? -162.14 119.31  
71 19 ASN A 86 ? ? 76.46   -1.96   
72 19 PRO A 88 ? ? -54.70  -71.56  
73 19 GLU A 89 ? ? -163.03 25.54   
74 20 PRO A 59 ? ? -103.65 -157.25 
75 20 ASN A 86 ? ? 74.18   -7.11   
76 20 GLU A 92 ? ? -122.18 -58.59  
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            512 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2K6X 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    5 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.5 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_ensemble_rms.atom_type                              ? 
_pdbx_nmr_ensemble_rms.bond_angle_rms_dev                     ? 
_pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error               ? 
_pdbx_nmr_ensemble_rms.chain_range_begin                      ? 
_pdbx_nmr_ensemble_rms.chain_range_end                        ? 
_pdbx_nmr_ensemble_rms.coord_average_rmsd_method              ? 
_pdbx_nmr_ensemble_rms.covalent_bond_rms_dev                  ? 
_pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error            ? 
_pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev                ? 
_pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error          ? 
_pdbx_nmr_ensemble_rms.distance_rms_dev                       0 
_pdbx_nmr_ensemble_rms.distance_rms_dev_error                 ? 
_pdbx_nmr_ensemble_rms.entry_id                               2K6X 
_pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev         ? 
_pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error   ? 
_pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev              ? 
_pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error        ? 
_pdbx_nmr_ensemble_rms.residue_range_begin                    ? 
_pdbx_nmr_ensemble_rms.residue_range_end                      ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2K6X 
_pdbx_nmr_representative.selection_criteria   'fewest violations' 
# 
_pdbx_nmr_sample_details.contents         
'300-800 uM [U-100% 15N] sigma1.1, 300-800 uM [U-100% 13C; U-100% 15N] sigma1.1, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
sigma1.1_1 300 uM '[U-100% 15N]'             1 
sigma1.1_2 300 uM '[U-100% 13C; U-100% 15N]' 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      100 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '2D 1H-13C HSQC'  
1 3  1 '3D HNCO'         
1 4  1 '3D CBCA(CO)NH'   
1 5  1 '3D HNCACB'       
1 6  1 '3D H(CCO)NH'     
1 7  1 '3D HBHA(CO)NH'   
1 8  1 '3D C(CO)NH'      
1 9  1 '3D HCCH-TOCSY'   
1 10 1 '3D 1H-15N NOESY' 
1 11 1 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_constraints.disulfide_bond_constraints_total_count        ? 
_pdbx_nmr_constraints.entry_id                                      2K6X 
_pdbx_nmr_constraints.hydrogen_bond_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_beta-angle_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_chi-angle_constraints_total_count          ? 
_pdbx_nmr_constraints.NA_delta-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count      ? 
_pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_other-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count       ? 
_pdbx_nmr_constraints.NOE_constraints_total                         ? 
_pdbx_nmr_constraints.NOE_interentity_total_count                   ? 
_pdbx_nmr_constraints.NOE_interproton_distance_evaluation           ? 
_pdbx_nmr_constraints.NOE_intraresidue_total_count                  ? 
_pdbx_nmr_constraints.NOE_long_range_total_count                    ? 
_pdbx_nmr_constraints.NOE_medium_range_total_count                  ? 
_pdbx_nmr_constraints.NOE_motional_averaging_correction             ? 
_pdbx_nmr_constraints.NOE_pseudoatom_corrections                    ? 
_pdbx_nmr_constraints.NOE_sequential_total_count                    ? 
_pdbx_nmr_constraints.protein_chi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_other_angle_constraints_total_count   ? 
_pdbx_nmr_constraints.protein_phi_angle_constraints_total_count     54 
_pdbx_nmr_constraints.protein_psi_angle_constraints_total_count     53 
# 
_pdbx_nmr_refine.entry_id           2K6X 
_pdbx_nmr_refine.method             'DGSA-distance geometry simulated annealing' 
_pdbx_nmr_refine.details            
'Used Aria2.1, Intensities were converted into distance restraints using the symmetry ambiguous distance restraints (ADR) protocol' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_software.authors          'Brunger A. T. et.al.' 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             CNS 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.ordinal          1 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
HIS N    N N N 123 
HIS CA   C N S 124 
HIS C    C N N 125 
HIS O    O N N 126 
HIS CB   C N N 127 
HIS CG   C Y N 128 
HIS ND1  N Y N 129 
HIS CD2  C Y N 130 
HIS CE1  C Y N 131 
HIS NE2  N Y N 132 
HIS OXT  O N N 133 
HIS H    H N N 134 
HIS H2   H N N 135 
HIS HA   H N N 136 
HIS HB2  H N N 137 
HIS HB3  H N N 138 
HIS HD1  H N N 139 
HIS HD2  H N N 140 
HIS HE1  H N N 141 
HIS HE2  H N N 142 
HIS HXT  H N N 143 
ILE N    N N N 144 
ILE CA   C N S 145 
ILE C    C N N 146 
ILE O    O N N 147 
ILE CB   C N S 148 
ILE CG1  C N N 149 
ILE CG2  C N N 150 
ILE CD1  C N N 151 
ILE OXT  O N N 152 
ILE H    H N N 153 
ILE H2   H N N 154 
ILE HA   H N N 155 
ILE HB   H N N 156 
ILE HG12 H N N 157 
ILE HG13 H N N 158 
ILE HG21 H N N 159 
ILE HG22 H N N 160 
ILE HG23 H N N 161 
ILE HD11 H N N 162 
ILE HD12 H N N 163 
ILE HD13 H N N 164 
ILE HXT  H N N 165 
LEU N    N N N 166 
LEU CA   C N S 167 
LEU C    C N N 168 
LEU O    O N N 169 
LEU CB   C N N 170 
LEU CG   C N N 171 
LEU CD1  C N N 172 
LEU CD2  C N N 173 
LEU OXT  O N N 174 
LEU H    H N N 175 
LEU H2   H N N 176 
LEU HA   H N N 177 
LEU HB2  H N N 178 
LEU HB3  H N N 179 
LEU HG   H N N 180 
LEU HD11 H N N 181 
LEU HD12 H N N 182 
LEU HD13 H N N 183 
LEU HD21 H N N 184 
LEU HD22 H N N 185 
LEU HD23 H N N 186 
LEU HXT  H N N 187 
LYS N    N N N 188 
LYS CA   C N S 189 
LYS C    C N N 190 
LYS O    O N N 191 
LYS CB   C N N 192 
LYS CG   C N N 193 
LYS CD   C N N 194 
LYS CE   C N N 195 
LYS NZ   N N N 196 
LYS OXT  O N N 197 
LYS H    H N N 198 
LYS H2   H N N 199 
LYS HA   H N N 200 
LYS HB2  H N N 201 
LYS HB3  H N N 202 
LYS HG2  H N N 203 
LYS HG3  H N N 204 
LYS HD2  H N N 205 
LYS HD3  H N N 206 
LYS HE2  H N N 207 
LYS HE3  H N N 208 
LYS HZ1  H N N 209 
LYS HZ2  H N N 210 
LYS HZ3  H N N 211 
LYS HXT  H N N 212 
MET N    N N N 213 
MET CA   C N S 214 
MET C    C N N 215 
MET O    O N N 216 
MET CB   C N N 217 
MET CG   C N N 218 
MET SD   S N N 219 
MET CE   C N N 220 
MET OXT  O N N 221 
MET H    H N N 222 
MET H2   H N N 223 
MET HA   H N N 224 
MET HB2  H N N 225 
MET HB3  H N N 226 
MET HG2  H N N 227 
MET HG3  H N N 228 
MET HE1  H N N 229 
MET HE2  H N N 230 
MET HE3  H N N 231 
MET HXT  H N N 232 
PHE N    N N N 233 
PHE CA   C N S 234 
PHE C    C N N 235 
PHE O    O N N 236 
PHE CB   C N N 237 
PHE CG   C Y N 238 
PHE CD1  C Y N 239 
PHE CD2  C Y N 240 
PHE CE1  C Y N 241 
PHE CE2  C Y N 242 
PHE CZ   C Y N 243 
PHE OXT  O N N 244 
PHE H    H N N 245 
PHE H2   H N N 246 
PHE HA   H N N 247 
PHE HB2  H N N 248 
PHE HB3  H N N 249 
PHE HD1  H N N 250 
PHE HD2  H N N 251 
PHE HE1  H N N 252 
PHE HE2  H N N 253 
PHE HZ   H N N 254 
PHE HXT  H N N 255 
PRO N    N N N 256 
PRO CA   C N S 257 
PRO C    C N N 258 
PRO O    O N N 259 
PRO CB   C N N 260 
PRO CG   C N N 261 
PRO CD   C N N 262 
PRO OXT  O N N 263 
PRO H    H N N 264 
PRO HA   H N N 265 
PRO HB2  H N N 266 
PRO HB3  H N N 267 
PRO HG2  H N N 268 
PRO HG3  H N N 269 
PRO HD2  H N N 270 
PRO HD3  H N N 271 
PRO HXT  H N N 272 
SER N    N N N 273 
SER CA   C N S 274 
SER C    C N N 275 
SER O    O N N 276 
SER CB   C N N 277 
SER OG   O N N 278 
SER OXT  O N N 279 
SER H    H N N 280 
SER H2   H N N 281 
SER HA   H N N 282 
SER HB2  H N N 283 
SER HB3  H N N 284 
SER HG   H N N 285 
SER HXT  H N N 286 
THR N    N N N 287 
THR CA   C N S 288 
THR C    C N N 289 
THR O    O N N 290 
THR CB   C N R 291 
THR OG1  O N N 292 
THR CG2  C N N 293 
THR OXT  O N N 294 
THR H    H N N 295 
THR H2   H N N 296 
THR HA   H N N 297 
THR HB   H N N 298 
THR HG1  H N N 299 
THR HG21 H N N 300 
THR HG22 H N N 301 
THR HG23 H N N 302 
THR HXT  H N N 303 
TYR N    N N N 304 
TYR CA   C N S 305 
TYR C    C N N 306 
TYR O    O N N 307 
TYR CB   C N N 308 
TYR CG   C Y N 309 
TYR CD1  C Y N 310 
TYR CD2  C Y N 311 
TYR CE1  C Y N 312 
TYR CE2  C Y N 313 
TYR CZ   C Y N 314 
TYR OH   O N N 315 
TYR OXT  O N N 316 
TYR H    H N N 317 
TYR H2   H N N 318 
TYR HA   H N N 319 
TYR HB2  H N N 320 
TYR HB3  H N N 321 
TYR HD1  H N N 322 
TYR HD2  H N N 323 
TYR HE1  H N N 324 
TYR HE2  H N N 325 
TYR HH   H N N 326 
TYR HXT  H N N 327 
VAL N    N N N 328 
VAL CA   C N S 329 
VAL C    C N N 330 
VAL O    O N N 331 
VAL CB   C N N 332 
VAL CG1  C N N 333 
VAL CG2  C N N 334 
VAL OXT  O N N 335 
VAL H    H N N 336 
VAL H2   H N N 337 
VAL HA   H N N 338 
VAL HB   H N N 339 
VAL HG11 H N N 340 
VAL HG12 H N N 341 
VAL HG13 H N N 342 
VAL HG21 H N N 343 
VAL HG22 H N N 344 
VAL HG23 H N N 345 
VAL HXT  H N N 346 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
ILE N   CA   sing N N 137 
ILE N   H    sing N N 138 
ILE N   H2   sing N N 139 
ILE CA  C    sing N N 140 
ILE CA  CB   sing N N 141 
ILE CA  HA   sing N N 142 
ILE C   O    doub N N 143 
ILE C   OXT  sing N N 144 
ILE CB  CG1  sing N N 145 
ILE CB  CG2  sing N N 146 
ILE CB  HB   sing N N 147 
ILE CG1 CD1  sing N N 148 
ILE CG1 HG12 sing N N 149 
ILE CG1 HG13 sing N N 150 
ILE CG2 HG21 sing N N 151 
ILE CG2 HG22 sing N N 152 
ILE CG2 HG23 sing N N 153 
ILE CD1 HD11 sing N N 154 
ILE CD1 HD12 sing N N 155 
ILE CD1 HD13 sing N N 156 
ILE OXT HXT  sing N N 157 
LEU N   CA   sing N N 158 
LEU N   H    sing N N 159 
LEU N   H2   sing N N 160 
LEU CA  C    sing N N 161 
LEU CA  CB   sing N N 162 
LEU CA  HA   sing N N 163 
LEU C   O    doub N N 164 
LEU C   OXT  sing N N 165 
LEU CB  CG   sing N N 166 
LEU CB  HB2  sing N N 167 
LEU CB  HB3  sing N N 168 
LEU CG  CD1  sing N N 169 
LEU CG  CD2  sing N N 170 
LEU CG  HG   sing N N 171 
LEU CD1 HD11 sing N N 172 
LEU CD1 HD12 sing N N 173 
LEU CD1 HD13 sing N N 174 
LEU CD2 HD21 sing N N 175 
LEU CD2 HD22 sing N N 176 
LEU CD2 HD23 sing N N 177 
LEU OXT HXT  sing N N 178 
LYS N   CA   sing N N 179 
LYS N   H    sing N N 180 
LYS N   H2   sing N N 181 
LYS CA  C    sing N N 182 
LYS CA  CB   sing N N 183 
LYS CA  HA   sing N N 184 
LYS C   O    doub N N 185 
LYS C   OXT  sing N N 186 
LYS CB  CG   sing N N 187 
LYS CB  HB2  sing N N 188 
LYS CB  HB3  sing N N 189 
LYS CG  CD   sing N N 190 
LYS CG  HG2  sing N N 191 
LYS CG  HG3  sing N N 192 
LYS CD  CE   sing N N 193 
LYS CD  HD2  sing N N 194 
LYS CD  HD3  sing N N 195 
LYS CE  NZ   sing N N 196 
LYS CE  HE2  sing N N 197 
LYS CE  HE3  sing N N 198 
LYS NZ  HZ1  sing N N 199 
LYS NZ  HZ2  sing N N 200 
LYS NZ  HZ3  sing N N 201 
LYS OXT HXT  sing N N 202 
MET N   CA   sing N N 203 
MET N   H    sing N N 204 
MET N   H2   sing N N 205 
MET CA  C    sing N N 206 
MET CA  CB   sing N N 207 
MET CA  HA   sing N N 208 
MET C   O    doub N N 209 
MET C   OXT  sing N N 210 
MET CB  CG   sing N N 211 
MET CB  HB2  sing N N 212 
MET CB  HB3  sing N N 213 
MET CG  SD   sing N N 214 
MET CG  HG2  sing N N 215 
MET CG  HG3  sing N N 216 
MET SD  CE   sing N N 217 
MET CE  HE1  sing N N 218 
MET CE  HE2  sing N N 219 
MET CE  HE3  sing N N 220 
MET OXT HXT  sing N N 221 
PHE N   CA   sing N N 222 
PHE N   H    sing N N 223 
PHE N   H2   sing N N 224 
PHE CA  C    sing N N 225 
PHE CA  CB   sing N N 226 
PHE CA  HA   sing N N 227 
PHE C   O    doub N N 228 
PHE C   OXT  sing N N 229 
PHE CB  CG   sing N N 230 
PHE CB  HB2  sing N N 231 
PHE CB  HB3  sing N N 232 
PHE CG  CD1  doub Y N 233 
PHE CG  CD2  sing Y N 234 
PHE CD1 CE1  sing Y N 235 
PHE CD1 HD1  sing N N 236 
PHE CD2 CE2  doub Y N 237 
PHE CD2 HD2  sing N N 238 
PHE CE1 CZ   doub Y N 239 
PHE CE1 HE1  sing N N 240 
PHE CE2 CZ   sing Y N 241 
PHE CE2 HE2  sing N N 242 
PHE CZ  HZ   sing N N 243 
PHE OXT HXT  sing N N 244 
PRO N   CA   sing N N 245 
PRO N   CD   sing N N 246 
PRO N   H    sing N N 247 
PRO CA  C    sing N N 248 
PRO CA  CB   sing N N 249 
PRO CA  HA   sing N N 250 
PRO C   O    doub N N 251 
PRO C   OXT  sing N N 252 
PRO CB  CG   sing N N 253 
PRO CB  HB2  sing N N 254 
PRO CB  HB3  sing N N 255 
PRO CG  CD   sing N N 256 
PRO CG  HG2  sing N N 257 
PRO CG  HG3  sing N N 258 
PRO CD  HD2  sing N N 259 
PRO CD  HD3  sing N N 260 
PRO OXT HXT  sing N N 261 
SER N   CA   sing N N 262 
SER N   H    sing N N 263 
SER N   H2   sing N N 264 
SER CA  C    sing N N 265 
SER CA  CB   sing N N 266 
SER CA  HA   sing N N 267 
SER C   O    doub N N 268 
SER C   OXT  sing N N 269 
SER CB  OG   sing N N 270 
SER CB  HB2  sing N N 271 
SER CB  HB3  sing N N 272 
SER OG  HG   sing N N 273 
SER OXT HXT  sing N N 274 
THR N   CA   sing N N 275 
THR N   H    sing N N 276 
THR N   H2   sing N N 277 
THR CA  C    sing N N 278 
THR CA  CB   sing N N 279 
THR CA  HA   sing N N 280 
THR C   O    doub N N 281 
THR C   OXT  sing N N 282 
THR CB  OG1  sing N N 283 
THR CB  CG2  sing N N 284 
THR CB  HB   sing N N 285 
THR OG1 HG1  sing N N 286 
THR CG2 HG21 sing N N 287 
THR CG2 HG22 sing N N 288 
THR CG2 HG23 sing N N 289 
THR OXT HXT  sing N N 290 
TYR N   CA   sing N N 291 
TYR N   H    sing N N 292 
TYR N   H2   sing N N 293 
TYR CA  C    sing N N 294 
TYR CA  CB   sing N N 295 
TYR CA  HA   sing N N 296 
TYR C   O    doub N N 297 
TYR C   OXT  sing N N 298 
TYR CB  CG   sing N N 299 
TYR CB  HB2  sing N N 300 
TYR CB  HB3  sing N N 301 
TYR CG  CD1  doub Y N 302 
TYR CG  CD2  sing Y N 303 
TYR CD1 CE1  sing Y N 304 
TYR CD1 HD1  sing N N 305 
TYR CD2 CE2  doub Y N 306 
TYR CD2 HD2  sing N N 307 
TYR CE1 CZ   doub Y N 308 
TYR CE1 HE1  sing N N 309 
TYR CE2 CZ   sing Y N 310 
TYR CE2 HE2  sing N N 311 
TYR CZ  OH   sing N N 312 
TYR OH  HH   sing N N 313 
TYR OXT HXT  sing N N 314 
VAL N   CA   sing N N 315 
VAL N   H    sing N N 316 
VAL N   H2   sing N N 317 
VAL CA  C    sing N N 318 
VAL CA  CB   sing N N 319 
VAL CA  HA   sing N N 320 
VAL C   O    doub N N 321 
VAL C   OXT  sing N N 322 
VAL CB  CG1  sing N N 323 
VAL CB  CG2  sing N N 324 
VAL CB  HB   sing N N 325 
VAL CG1 HG11 sing N N 326 
VAL CG1 HG12 sing N N 327 
VAL CG1 HG13 sing N N 328 
VAL CG2 HG21 sing N N 329 
VAL CG2 HG22 sing N N 330 
VAL CG2 HG23 sing N N 331 
VAL OXT HXT  sing N N 332 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Bruker AVANCE 1 'Bruker Avance' 
700 Bruker AVANCE 2 'Bruker Avance' 
800 Bruker AVANCE 3 'Bruker Avance' 
# 
_atom_sites.entry_id                    2K6X 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_