data_2K7K # _entry.id 2K7K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K7K pdb_00002k7k 10.2210/pdb2k7k/pdb RCSB RCSB100775 ? ? WWPDB D_1000100775 ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 2k7j _pdbx_database_related.db_name PDB _pdbx_database_related.details 'Entry containing AcPh surface charge optimized mutant' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K7K _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-08-13 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gribenko, A.V.' 1 'Patel, M.M.' 2 'Liu, J.' 3 'McCallum, S.A.' 4 'Wang, C.' 5 'Makhatadze, G.I.' 6 # _citation.id primary _citation.title 'Rational stabilization of enzymes by computational redesign of surface charge-charge interactions' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 106 _citation.page_first 2601 _citation.page_last 2606 _citation.year 2009 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19196981 _citation.pdbx_database_id_DOI 10.1073/pnas.0808220106 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gribenko, A.V.' 1 ? primary 'Patel, M.M.' 2 ? primary 'Liu, J.' 3 ? primary 'McCallum, S.A.' 4 ? primary 'Wang, C.' 5 ? primary 'Makhatadze, G.I.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Acylphosphatase-1 _entity.formula_weight 11203.696 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.6.1.7 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Acylphosphate phosphohydrolase 1, Acylphosphatase, organ-common type isozyme, Acylphosphatase, erythrocyte isozyme' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKAN FNNEKVILKLDYSDFQIVK ; _entity_poly.pdbx_seq_one_letter_code_can ;GAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKAN FNNEKVILKLDYSDFQIVK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 GLU n 1 4 GLY n 1 5 ASN n 1 6 THR n 1 7 LEU n 1 8 ILE n 1 9 SER n 1 10 VAL n 1 11 ASP n 1 12 TYR n 1 13 GLU n 1 14 ILE n 1 15 PHE n 1 16 GLY n 1 17 LYS n 1 18 VAL n 1 19 GLN n 1 20 GLY n 1 21 VAL n 1 22 PHE n 1 23 PHE n 1 24 ARG n 1 25 LYS n 1 26 HIS n 1 27 THR n 1 28 GLN n 1 29 ALA n 1 30 GLU n 1 31 GLY n 1 32 LYS n 1 33 LYS n 1 34 LEU n 1 35 GLY n 1 36 LEU n 1 37 VAL n 1 38 GLY n 1 39 TRP n 1 40 VAL n 1 41 GLN n 1 42 ASN n 1 43 THR n 1 44 ASP n 1 45 ARG n 1 46 GLY n 1 47 THR n 1 48 VAL n 1 49 GLN n 1 50 GLY n 1 51 GLN n 1 52 LEU n 1 53 GLN n 1 54 GLY n 1 55 PRO n 1 56 ILE n 1 57 SER n 1 58 LYS n 1 59 VAL n 1 60 ARG n 1 61 HIS n 1 62 MET n 1 63 GLN n 1 64 GLU n 1 65 TRP n 1 66 LEU n 1 67 GLU n 1 68 THR n 1 69 ARG n 1 70 GLY n 1 71 SER n 1 72 PRO n 1 73 LYS n 1 74 SER n 1 75 HIS n 1 76 ILE n 1 77 ASP n 1 78 LYS n 1 79 ALA n 1 80 ASN n 1 81 PHE n 1 82 ASN n 1 83 ASN n 1 84 GLU n 1 85 LYS n 1 86 VAL n 1 87 ILE n 1 88 LEU n 1 89 LYS n 1 90 LEU n 1 91 ASP n 1 92 TYR n 1 93 SER n 1 94 ASP n 1 95 PHE n 1 96 GLN n 1 97 ILE n 1 98 VAL n 1 99 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ACYP1, ACYPE' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) pLysE' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pGia _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ACYP1_HUMAN _struct_ref.pdbx_db_accession P07311 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANF NNEKVILKLDYSDFQIVK ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K7K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 99 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07311 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 99 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 99 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2K7K _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P07311 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D C(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HNCACB' 1 6 1 '3D HN(CO)CA' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' 1 9 1 '3D 1H-15N TOCSY' 1 10 1 '3D HCCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 5.7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.6 mM protein, 20 mM sodium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2K7K _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K7K _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K7K _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA ? 1 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 2 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 3 'Bruker Biospin' collection TopSpin 2.0 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRPipe ? 5 Goddard 'chemical shift assignment' Sparky ? 6 Goddard 'data analysis' Sparky ? 7 Goddard 'peak picking' Sparky ? 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K7K _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K7K _struct.title 'Human Acylphosphatase (AcPh) common type' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K7K _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'PROTEIN, Acetylation, Hydrolase' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 23 ? GLY A 35 ? PHE A 23 GLY A 35 1 ? 13 HELX_P HELX_P2 2 ILE A 56 ? GLU A 67 ? ILE A 56 GLU A 67 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 37 ? GLY A 38 ? VAL A 37 GLY A 38 A 2 LEU A 52 ? PRO A 55 ? LEU A 52 PRO A 55 A 3 LEU A 7 ? ASP A 11 ? LEU A 7 ASP A 11 A 4 ASN A 82 ? VAL A 86 ? ASN A 82 VAL A 86 B 1 ILE A 14 ? GLY A 16 ? ILE A 14 GLY A 16 B 2 ILE A 76 ? ALA A 79 ? ILE A 76 ALA A 79 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 37 ? N VAL A 37 O GLN A 53 ? O GLN A 53 A 2 3 O GLY A 54 ? O GLY A 54 N ILE A 8 ? N ILE A 8 A 3 4 N ASP A 11 ? N ASP A 11 O ASN A 82 ? O ASN A 82 B 1 2 N PHE A 15 ? N PHE A 15 O ASP A 77 ? O ASP A 77 # _atom_sites.entry_id 2K7K _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 TRP 65 65 65 TRP TRP A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 LYS 99 99 99 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-02-17 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate' 20 mM ? 1 'sodium chloride' 50 mM ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 6 ? ? -61.88 95.41 2 1 VAL A 18 ? ? -97.92 31.83 3 1 GLN A 19 ? ? -107.68 -70.94 4 1 ARG A 45 ? ? -70.44 -71.08 5 1 TRP A 65 ? ? -131.82 -41.91 6 1 THR A 68 ? ? -100.32 -64.39 7 1 LYS A 89 ? ? -177.30 -177.88 8 2 LYS A 17 ? ? -91.61 45.65 9 2 GLN A 19 ? ? -115.87 68.35 10 2 TRP A 39 ? ? -174.09 137.53 11 2 GLN A 51 ? ? -172.20 134.56 12 2 THR A 68 ? ? -99.12 -69.49 13 2 ARG A 69 ? ? -51.91 -74.19 14 2 SER A 74 ? ? -115.16 64.68 15 2 ASN A 83 ? ? -68.09 89.40 16 2 LEU A 88 ? ? -52.02 -72.71 17 2 LEU A 90 ? ? -56.78 172.38 18 3 LEU A 36 ? ? -132.49 -58.47 19 3 ASP A 44 ? ? -98.07 37.11 20 3 ARG A 45 ? ? -130.90 -40.06 21 3 SER A 74 ? ? -145.58 57.84 22 3 HIS A 75 ? ? -52.41 106.73 23 3 ASN A 83 ? ? -65.96 90.65 24 4 TRP A 65 ? ? -133.48 -42.79 25 4 ARG A 69 ? ? -96.43 -75.08 26 4 ILE A 76 ? ? -104.49 71.51 27 4 ASN A 83 ? ? -67.97 88.07 28 5 GLU A 3 ? ? -129.87 -74.39 29 5 LYS A 17 ? ? -91.33 47.79 30 5 GLN A 51 ? ? -61.93 99.44 31 5 SER A 74 ? ? -118.92 71.79 32 5 LYS A 78 ? ? -164.34 111.31 33 5 GLU A 84 ? ? 64.86 117.07 34 5 LEU A 90 ? ? -52.62 103.84 35 6 ASN A 5 ? ? -65.59 91.35 36 6 LYS A 17 ? ? -89.48 49.31 37 6 GLN A 19 ? ? -91.34 53.41 38 6 ARG A 45 ? ? -176.59 100.11 39 6 THR A 68 ? ? -95.92 -73.43 40 6 ARG A 69 ? ? -73.12 -72.73 41 6 HIS A 75 ? ? -52.08 106.58 42 6 ASN A 83 ? ? -66.53 90.22 43 7 LYS A 17 ? ? -94.44 39.58 44 7 VAL A 18 ? ? -96.03 41.03 45 7 ARG A 24 ? ? -132.98 -52.88 46 7 LEU A 34 ? ? -98.37 -60.07 47 7 LEU A 36 ? ? -144.07 -57.83 48 7 GLU A 64 ? ? -97.78 30.92 49 7 TRP A 65 ? ? -132.77 -42.73 50 7 THR A 68 ? ? -97.32 -70.87 51 7 LYS A 73 ? ? -96.84 32.01 52 7 ASN A 83 ? ? -65.99 91.05 53 8 GLU A 13 ? ? -166.62 110.65 54 8 LYS A 17 ? ? -91.22 46.36 55 8 GLN A 19 ? ? -90.72 46.96 56 8 ARG A 45 ? ? -177.61 96.25 57 8 LYS A 58 ? ? -152.95 -44.55 58 8 TRP A 65 ? ? -131.35 -40.62 59 8 THR A 68 ? ? -92.78 -72.74 60 8 ASN A 83 ? ? -51.89 -71.95 61 9 LEU A 36 ? ? -136.98 -57.21 62 9 GLU A 64 ? ? -97.87 31.99 63 9 TRP A 65 ? ? -135.20 -43.36 64 9 THR A 68 ? ? -105.13 -68.36 65 9 ARG A 69 ? ? -51.95 -74.52 66 9 SER A 74 ? ? -115.12 66.64 67 9 LYS A 78 ? ? -165.37 103.28 68 9 ASN A 83 ? ? -67.54 89.41 69 9 LEU A 88 ? ? -51.89 -72.67 70 9 LEU A 90 ? ? -55.99 170.91 71 10 ARG A 45 ? ? -112.85 -74.33 72 10 THR A 68 ? ? -102.72 -62.94 73 10 ASN A 83 ? ? -65.90 90.60 74 11 ASN A 5 ? ? -105.91 56.07 75 11 LYS A 17 ? ? -91.38 46.17 76 11 PHE A 22 ? ? -105.36 41.43 77 11 LYS A 73 ? ? -94.95 40.21 78 12 LEU A 36 ? ? -133.95 -67.13 79 12 HIS A 61 ? ? -121.11 -51.87 80 12 GLU A 64 ? ? -95.93 33.37 81 12 TRP A 65 ? ? -133.76 -41.35 82 12 ILE A 76 ? ? -119.18 70.25 83 12 LEU A 88 ? ? -58.17 -71.86 84 13 GLU A 3 ? ? -120.29 -74.55 85 13 ASN A 5 ? ? -61.59 97.21 86 13 LEU A 7 ? ? -55.64 106.16 87 13 VAL A 21 ? ? -175.59 146.49 88 13 ARG A 45 ? ? -176.87 91.45 89 13 TRP A 65 ? ? -133.48 -40.67 90 13 ARG A 69 ? ? -178.16 -179.31 91 13 LYS A 73 ? ? -96.98 37.75 92 13 HIS A 75 ? ? -52.65 105.88 93 13 ASN A 83 ? ? -66.53 90.07 94 13 ASP A 94 ? ? -172.71 139.00 95 14 THR A 6 ? ? -105.73 74.47 96 14 LYS A 17 ? ? -91.02 46.76 97 14 LEU A 36 ? ? -135.22 -73.24 98 14 TRP A 39 ? ? -173.71 148.67 99 14 THR A 68 ? ? -141.50 -43.68 100 14 ASN A 83 ? ? -66.40 90.12 101 15 ALA A 2 ? ? -174.97 127.75 102 15 LYS A 17 ? ? -91.42 46.20 103 15 LEU A 34 ? ? -123.43 -70.06 104 15 LEU A 36 ? ? -133.52 -62.46 105 15 ASN A 83 ? ? -66.52 89.87 106 16 LYS A 17 ? ? -92.82 46.09 107 16 PHE A 22 ? ? -109.33 51.13 108 16 ARG A 24 ? ? -94.44 39.03 109 16 LYS A 25 ? ? -135.74 -41.27 110 16 THR A 47 ? ? -53.73 172.68 111 16 LYS A 73 ? ? -96.01 31.44 112 16 ASN A 83 ? ? -68.46 88.77 113 17 VAL A 37 ? ? -56.08 175.06 114 17 TRP A 39 ? ? -173.61 144.48 115 17 TRP A 65 ? ? -133.54 -41.45 116 17 THR A 68 ? ? -78.62 -72.99 117 17 ASN A 83 ? ? -66.51 90.09 118 18 LYS A 33 ? ? -58.77 -71.34 119 18 THR A 68 ? ? -136.23 -43.92 120 18 SER A 74 ? ? -116.68 66.60 121 18 ILE A 76 ? ? -111.15 75.06 122 18 ASN A 83 ? ? -67.51 89.17 123 19 LYS A 17 ? ? -93.95 41.25 124 19 TRP A 65 ? ? -130.56 -40.88 125 19 ILE A 76 ? ? -111.60 77.15 126 19 LYS A 78 ? ? -161.42 104.33 127 19 GLU A 84 ? ? -55.23 172.02 128 20 TYR A 12 ? ? -172.14 143.23 129 20 VAL A 48 ? ? -111.27 78.06 130 20 TRP A 65 ? ? -132.60 -40.80 131 20 ILE A 76 ? ? -118.61 78.76 #