data_2K7R # _entry.id 2K7R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K7R pdb_00002k7r 10.2210/pdb2k7r/pdb RCSB RCSB100782 ? ? BMRB 15926 ? ? WWPDB D_1000100782 ? ? # _pdbx_database_related.db_id 15926 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K7R _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-08-19 _pdbx_database_status.SG_entry . _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Loscha, K.V.' 1 'Jaudzems, K.' 2 'Ioannou, C.' 3 'Su, X.C.' 4 'Hill, F.R.' 5 'Otting, G.' 6 'Dixon, N.E.' 7 'Liepinsh, E.' 8 # _citation.id primary _citation.title 'A novel zinc-binding fold in the helicase interaction domain of the Bacillus subtilis DnaI helicase loader' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 37 _citation.page_first 2395 _citation.page_last 2404 _citation.year 2009 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19255093 _citation.pdbx_database_id_DOI 10.1093/nar/gkp092 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Loscha, K.V.' 1 ? primary 'Jaudzems, K.' 2 ? primary 'Ioannou, C.' 3 ? primary 'Su, X.C.' 4 ? primary 'Hill, F.R.' 5 ? primary 'Otting, G.' 6 ? primary 'Dixon, N.E.' 7 ? primary 'Liepinsh, E.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Primosomal protein dnaI' 12543.268 1 ? ? 'UNP residues 1-106' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEPIGRSLQGVTGRPDFQKRLEQMKEKVMKDQDVQAFLKENEEVIDQKMIEKSLNKLYEYIEQSKNCSYCSEDENCNNLL EGYHPKLVVNGRSIDIEYYECPVKRK ; _entity_poly.pdbx_seq_one_letter_code_can ;MEPIGRSLQGVTGRPDFQKRLEQMKEKVMKDQDVQAFLKENEEVIDQKMIEKSLNKLYEYIEQSKNCSYCSEDENCNNLL EGYHPKLVVNGRSIDIEYYECPVKRK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 PRO n 1 4 ILE n 1 5 GLY n 1 6 ARG n 1 7 SER n 1 8 LEU n 1 9 GLN n 1 10 GLY n 1 11 VAL n 1 12 THR n 1 13 GLY n 1 14 ARG n 1 15 PRO n 1 16 ASP n 1 17 PHE n 1 18 GLN n 1 19 LYS n 1 20 ARG n 1 21 LEU n 1 22 GLU n 1 23 GLN n 1 24 MET n 1 25 LYS n 1 26 GLU n 1 27 LYS n 1 28 VAL n 1 29 MET n 1 30 LYS n 1 31 ASP n 1 32 GLN n 1 33 ASP n 1 34 VAL n 1 35 GLN n 1 36 ALA n 1 37 PHE n 1 38 LEU n 1 39 LYS n 1 40 GLU n 1 41 ASN n 1 42 GLU n 1 43 GLU n 1 44 VAL n 1 45 ILE n 1 46 ASP n 1 47 GLN n 1 48 LYS n 1 49 MET n 1 50 ILE n 1 51 GLU n 1 52 LYS n 1 53 SER n 1 54 LEU n 1 55 ASN n 1 56 LYS n 1 57 LEU n 1 58 TYR n 1 59 GLU n 1 60 TYR n 1 61 ILE n 1 62 GLU n 1 63 GLN n 1 64 SER n 1 65 LYS n 1 66 ASN n 1 67 CYS n 1 68 SER n 1 69 TYR n 1 70 CYS n 1 71 SER n 1 72 GLU n 1 73 ASP n 1 74 GLU n 1 75 ASN n 1 76 CYS n 1 77 ASN n 1 78 ASN n 1 79 LEU n 1 80 LEU n 1 81 GLU n 1 82 GLY n 1 83 TYR n 1 84 HIS n 1 85 PRO n 1 86 LYS n 1 87 LEU n 1 88 VAL n 1 89 VAL n 1 90 ASN n 1 91 GLY n 1 92 ARG n 1 93 SER n 1 94 ILE n 1 95 ASP n 1 96 ILE n 1 97 GLU n 1 98 TYR n 1 99 TYR n 1 100 GLU n 1 101 CYS n 1 102 PRO n 1 103 VAL n 1 104 LYS n 1 105 ARG n 1 106 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'dnaI, ytxA, BSU28980' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector pKL1272 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DNAI_BACSU _struct_ref.pdbx_db_accession P06567 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEPIGRSLQGVTGRPDFQKRLEQMKEKVMKDQDVQAFLKENEEVIDQKMIEKSLNKLYEYIEQSKNCSYCSEDENCNNLL EGYHPKLVVNGRSIDIEYYECPVKRK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K7R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 106 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06567 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 106 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 106 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D HNHA' 1 3 1 '2D 1H-1H NOESY' 1 4 1 '2D DQF-COSY' 1 5 1 '2D 1H-1H TOCSY' 1 6 1 '2D 1H-15N HSQC' 1 7 1 '2D 1H-15N HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.5mM [U-95% 15N] DnaI, 0.5mM zinc ion, 10% [U-99% 2H] D2O, 90% H2O, 10mM sodium phosphate, 0.1% sodium azide, 100mM sodium chloride, 1mM DTT, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2K7R _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K7R _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K7R _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges, Read' refinement CNS 1.2 1 'Guntert, Mumenthaler, Wuthrich' 'structure solution' CYANA 2.1 2 'Koradi, Billeter, Wuthrich' 'data analysis' MOLMOL . 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer, Bax' processing NMRPipe . 4 'Laskowski, MacArthur, Smith, Jones, Hutchinson, Morris, Moss, Tho' 'data analysis' Procheck . 5 'Bartels et al.' 'chemical shift assignment' XEASY . 6 'Bartels et al.' 'peak picking' XEASY . 7 'Bruker Biospin' collection TopSpin . 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;The helicase loader protein DnaI (the Bacillus subtilis homologue of Escherichia coli DnaC) is required to load the hexameric helicase DnaC (the B. subtilis homologue of E. coli DnaB) onto DNA at the start of replication ; _exptl.entry_id 2K7R _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K7R _struct.title 'N-terminal domain of the Bacillus subtilis helicase-loading protein DnaI' _struct.pdbx_model_details ;The helicase loader protein DnaI (the Bacillus subtilis homologue of Escherichia coli DnaC) is required to load the hexameric helicase DnaC (the B. subtilis homologue of E. coli DnaB) onto DNA at the start of replication ; _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K7R _struct_keywords.pdbx_keywords REPLICATION _struct_keywords.text 'DnaI N-terminal domain, helicase-loading protein, ATP-binding, DNA replication, Nucleotide-binding, Primosome, REPLICATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 15 ? MET A 29 ? PRO A 15 MET A 29 1 ? 15 HELX_P HELX_P2 2 ASP A 31 ? ASN A 41 ? ASP A 31 ASN A 41 1 ? 11 HELX_P HELX_P3 3 ASP A 46 ? SER A 53 ? ASP A 46 SER A 53 1 ? 8 HELX_P HELX_P4 4 SER A 53 ? GLN A 63 ? SER A 53 GLN A 63 1 ? 11 HELX_P HELX_P5 5 PRO A 102 ? ARG A 105 ? PRO A 102 ARG A 105 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 67 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 67 A ZN 129 1_555 ? ? ? ? ? ? ? 2.295 ? ? metalc2 metalc ? ? A CYS 70 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 70 A ZN 129 1_555 ? ? ? ? ? ? ? 2.298 ? ? metalc3 metalc ? ? A HIS 84 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 84 A ZN 129 1_555 ? ? ? ? ? ? ? 1.996 ? ? metalc4 metalc ? ? A CYS 101 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 101 A ZN 129 1_555 ? ? ? ? ? ? ? 2.298 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 83 ? ASN A 90 ? TYR A 83 ASN A 90 A 2 SER A 93 ? GLU A 100 ? SER A 93 GLU A 100 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 88 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 88 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ASP _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 95 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ASP _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 95 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 129 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 129' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 LYS A 65 ? LYS A 65 . ? 1_555 ? 2 AC1 5 ASN A 66 ? ASN A 66 . ? 1_555 ? 3 AC1 5 CYS A 67 ? CYS A 67 . ? 1_555 ? 4 AC1 5 GLY A 82 ? GLY A 82 . ? 1_555 ? 5 AC1 5 CYS A 101 ? CYS A 101 . ? 1_555 ? # _atom_sites.entry_id 2K7R _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 LYS 106 106 106 LYS LYS A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 129 _pdbx_nonpoly_scheme.auth_seq_num 129 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 67 ? A CYS 67 ? 1_555 ZN ? B ZN . ? A ZN 129 ? 1_555 SG ? A CYS 70 ? A CYS 70 ? 1_555 109.1 ? 2 SG ? A CYS 67 ? A CYS 67 ? 1_555 ZN ? B ZN . ? A ZN 129 ? 1_555 NE2 ? A HIS 84 ? A HIS 84 ? 1_555 108.3 ? 3 SG ? A CYS 70 ? A CYS 70 ? 1_555 ZN ? B ZN . ? A ZN 129 ? 1_555 NE2 ? A HIS 84 ? A HIS 84 ? 1_555 113.4 ? 4 SG ? A CYS 67 ? A CYS 67 ? 1_555 ZN ? B ZN . ? A ZN 129 ? 1_555 SG ? A CYS 101 ? A CYS 101 ? 1_555 107.3 ? 5 SG ? A CYS 70 ? A CYS 70 ? 1_555 ZN ? B ZN . ? A ZN 129 ? 1_555 SG ? A CYS 101 ? A CYS 101 ? 1_555 109.8 ? 6 NE2 ? A HIS 84 ? A HIS 84 ? 1_555 ZN ? B ZN . ? A ZN 129 ? 1_555 SG ? A CYS 101 ? A CYS 101 ? 1_555 108.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-03-03 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 7 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 8 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 9 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id DnaI 0.5 mM '[U-95% 15N]' 1 'ZINC ION' 0.5 mM ? 1 D2O 10 % '[U-99% 2H]' 1 H2O 90 % ? 1 'sodium phosphate' 10 mM ? 1 'sodium azide' 0.1 % ? 1 'sodium chloride' 100 mM ? 1 DTT 1 mM ? 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 33 ? ? HH A TYR 60 ? ? 1.57 2 2 OE1 A GLU 26 ? ? HZ1 A LYS 30 ? ? 1.59 3 3 OE1 A GLU 26 ? ? HZ3 A LYS 30 ? ? 1.57 4 3 OE2 A GLU 100 ? ? HZ1 A LYS 104 ? ? 1.58 5 4 HZ2 A LYS 19 ? ? OE2 A GLU 22 ? ? 1.58 6 4 OD1 A ASP 33 ? ? HZ3 A LYS 65 ? ? 1.59 7 4 OE1 A GLU 100 ? ? HZ1 A LYS 104 ? ? 1.60 8 5 OE1 A GLU 26 ? ? HZ1 A LYS 30 ? ? 1.55 9 5 HZ1 A LYS 48 ? ? OE1 A GLU 51 ? ? 1.60 10 6 O A ASP 73 ? ? HG A CYS 76 ? ? 1.59 11 6 OE2 A GLU 100 ? ? HE A ARG 105 ? ? 1.60 12 8 OD1 A ASP 33 ? ? HZ3 A LYS 65 ? ? 1.55 13 9 OD2 A ASP 33 ? ? HZ1 A LYS 65 ? ? 1.60 14 10 O A GLN 63 ? ? HG A SER 64 ? ? 1.59 15 12 OD1 A ASP 31 ? ? HZ1 A LYS 65 ? ? 1.57 16 12 OE2 A GLU 26 ? ? HZ1 A LYS 30 ? ? 1.58 17 12 OD2 A ASP 33 ? ? HH A TYR 60 ? ? 1.58 18 13 OD2 A ASP 33 ? ? HZ3 A LYS 65 ? ? 1.56 19 15 HZ2 A LYS 25 ? ? OE2 A GLU 51 ? ? 1.53 20 15 HG A SER 71 ? ? OD2 A ASP 73 ? ? 1.58 21 15 OE1 A GLU 26 ? ? HZ1 A LYS 30 ? ? 1.59 22 17 OE2 A GLU 26 ? ? HZ1 A LYS 30 ? ? 1.56 23 17 OE1 A GLU 100 ? ? HZ1 A LYS 104 ? ? 1.59 24 19 OD2 A ASP 31 ? ? HZ1 A LYS 65 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 66 ? ? -102.55 -160.89 2 1 ASP A 73 ? ? -68.16 86.21 3 1 LEU A 80 ? ? -87.12 49.19 4 2 GLN A 9 ? ? -141.50 -154.64 5 2 ARG A 14 ? ? -154.45 87.53 6 2 ASN A 66 ? ? -92.22 -159.93 7 3 THR A 12 ? ? -79.39 39.87 8 3 GLN A 63 ? ? -74.36 -167.15 9 3 ASN A 66 ? ? -122.78 -160.09 10 3 ASN A 77 ? ? -79.08 21.81 11 4 ASN A 66 ? ? -102.19 -163.18 12 5 PRO A 3 ? ? -68.09 91.40 13 5 GLN A 9 ? ? -83.77 42.10 14 5 ARG A 14 ? ? -155.04 78.62 15 5 ASN A 77 ? ? -92.26 37.70 16 6 GLN A 9 ? ? -140.55 21.34 17 7 LEU A 8 ? ? -90.40 -60.52 18 7 CYS A 70 ? ? -140.17 -0.79 19 7 ASN A 75 ? ? -69.65 80.60 20 7 ARG A 105 ? ? 45.86 28.72 21 8 PRO A 15 ? ? -62.73 91.39 22 9 ASN A 66 ? ? -112.63 -165.65 23 9 LEU A 79 ? ? -74.06 -74.46 24 10 PRO A 3 ? ? -68.32 95.04 25 10 SER A 64 ? ? -178.84 118.37 26 10 ASN A 66 ? ? -115.71 -157.81 27 10 CYS A 70 ? ? -151.64 19.25 28 10 CYS A 76 ? ? -152.07 26.18 29 11 PRO A 3 ? ? -59.00 105.06 30 12 CYS A 70 ? ? -132.24 -44.28 31 12 LEU A 79 ? ? -75.26 -79.22 32 13 PRO A 3 ? ? -66.54 86.86 33 13 CYS A 70 ? ? -143.67 -28.19 34 13 ASP A 73 ? ? -56.13 104.36 35 14 GLU A 2 ? ? -169.76 86.28 36 14 PRO A 3 ? ? -68.51 85.92 37 14 CYS A 70 ? ? -134.77 -38.92 38 14 PRO A 102 ? ? -67.83 5.57 39 15 ARG A 14 ? ? -154.89 85.80 40 16 ASN A 66 ? ? -138.52 -157.28 41 16 ASN A 77 ? ? -116.29 77.78 42 17 CYS A 70 ? ? -145.51 -44.51 43 18 ARG A 6 ? ? -96.00 34.22 44 18 ASN A 78 ? ? -176.27 149.15 45 18 ARG A 105 ? ? -83.21 39.14 46 19 GLN A 63 ? ? -65.81 -175.16 47 19 SER A 64 ? ? -59.92 102.60 48 19 ASN A 66 ? ? -124.94 -156.20 49 19 LEU A 79 ? ? -89.60 -79.25 50 20 PRO A 3 ? ? -65.91 99.04 51 20 GLN A 9 ? ? -129.86 -61.15 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #