data_2K8H # _entry.id 2K8H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K8H pdb_00002k8h 10.2210/pdb2k8h/pdb RCSB RCSB100808 ? ? WWPDB D_1000100808 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-04-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K8H _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-09-10 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Shang, Q.' 1 'Tu, X.' 2 # _citation.id primary _citation.title 'Solution structure of SUMO from Trypanosoma brucei and its interaction with Ubc9' _citation.journal_abbrev Proteins _citation.journal_volume 76 _citation.page_first 266 _citation.page_last 269 _citation.year 2009 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19343802 _citation.pdbx_database_id_DOI 10.1002/prot.22409 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shang, Q.' 1 ? primary 'Xu, C.' 2 ? primary 'Zhang, J.' 3 ? primary 'Zhang, X.' 4 ? primary 'Tu, X.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Small ubiquitin protein' _entity.formula_weight 12059.369 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 8-108' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSNNGGEPSNNGGEGAEGTCKEETALVAVKVVNADGAEMFFRIKSRTALKKLIDTYCKKQGISRNSVRFLFDGTPIDETK TPEELGMEDDDVIDAMVEQTGGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSNNGGEPSNNGGEGAEGTCKEETALVAVKVVNADGAEMFFRIKSRTALKKLIDTYCKKQGISRNSVRFLFDGTPIDETK TPEELGMEDDDVIDAMVEQTGGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASN n 1 4 ASN n 1 5 GLY n 1 6 GLY n 1 7 GLU n 1 8 PRO n 1 9 SER n 1 10 ASN n 1 11 ASN n 1 12 GLY n 1 13 GLY n 1 14 GLU n 1 15 GLY n 1 16 ALA n 1 17 GLU n 1 18 GLY n 1 19 THR n 1 20 CYS n 1 21 LYS n 1 22 GLU n 1 23 GLU n 1 24 THR n 1 25 ALA n 1 26 LEU n 1 27 VAL n 1 28 ALA n 1 29 VAL n 1 30 LYS n 1 31 VAL n 1 32 VAL n 1 33 ASN n 1 34 ALA n 1 35 ASP n 1 36 GLY n 1 37 ALA n 1 38 GLU n 1 39 MET n 1 40 PHE n 1 41 PHE n 1 42 ARG n 1 43 ILE n 1 44 LYS n 1 45 SER n 1 46 ARG n 1 47 THR n 1 48 ALA n 1 49 LEU n 1 50 LYS n 1 51 LYS n 1 52 LEU n 1 53 ILE n 1 54 ASP n 1 55 THR n 1 56 TYR n 1 57 CYS n 1 58 LYS n 1 59 LYS n 1 60 GLN n 1 61 GLY n 1 62 ILE n 1 63 SER n 1 64 ARG n 1 65 ASN n 1 66 SER n 1 67 VAL n 1 68 ARG n 1 69 PHE n 1 70 LEU n 1 71 PHE n 1 72 ASP n 1 73 GLY n 1 74 THR n 1 75 PRO n 1 76 ILE n 1 77 ASP n 1 78 GLU n 1 79 THR n 1 80 LYS n 1 81 THR n 1 82 PRO n 1 83 GLU n 1 84 GLU n 1 85 LEU n 1 86 GLY n 1 87 MET n 1 88 GLU n 1 89 ASP n 1 90 ASP n 1 91 ASP n 1 92 VAL n 1 93 ILE n 1 94 ASP n 1 95 ALA n 1 96 MET n 1 97 VAL n 1 98 GLU n 1 99 GLN n 1 100 THR n 1 101 GLY n 1 102 GLY n 1 103 LEU n 1 104 GLU n 1 105 HIS n 1 106 HIS n 1 107 HIS n 1 108 HIS n 1 109 HIS n 1 110 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Tb927.5.3210 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Trypanosoma brucei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5691 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET22b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 MET 96 96 96 MET MET A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 LEU 103 103 ? ? ? A . n A 1 104 GLU 104 104 ? ? ? A . n A 1 105 HIS 105 105 ? ? ? A . n A 1 106 HIS 106 106 ? ? ? A . n A 1 107 HIS 107 107 ? ? ? A . n A 1 108 HIS 108 108 ? ? ? A . n A 1 109 HIS 109 109 ? ? ? A . n A 1 110 HIS 110 110 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K8H _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K8H _struct.title 'Solution structure of SUMO from Trypanosoma brucei' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K8H _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'SUMO, Trypanosoma brucei, Post-translational modifier, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q57Z72_9TRYP _struct_ref.pdbx_db_accession Q57Z72 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SNNGGEPSNNGGEGAEGTCKEETALVAVKVVNADGAEMFFRIKSRTALKKLIDTYCKKQGISRNSVRFLFDGTPIDETKT PEELGMEDDDVIDAMVEQTGG ; _struct_ref.pdbx_align_begin 8 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K8H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 102 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q57Z72 _struct_ref_seq.db_align_beg 8 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 102 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K8H MET A 1 ? UNP Q57Z72 ? ? 'expression tag' 1 1 1 2K8H LEU A 103 ? UNP Q57Z72 ? ? 'expression tag' 103 2 1 2K8H GLU A 104 ? UNP Q57Z72 ? ? 'expression tag' 104 3 1 2K8H HIS A 105 ? UNP Q57Z72 ? ? 'expression tag' 105 4 1 2K8H HIS A 106 ? UNP Q57Z72 ? ? 'expression tag' 106 5 1 2K8H HIS A 107 ? UNP Q57Z72 ? ? 'expression tag' 107 6 1 2K8H HIS A 108 ? UNP Q57Z72 ? ? 'expression tag' 108 7 1 2K8H HIS A 109 ? UNP Q57Z72 ? ? 'expression tag' 109 8 1 2K8H HIS A 110 ? UNP Q57Z72 ? ? 'expression tag' 110 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 48 ? GLY A 61 ? ALA A 48 GLY A 61 1 ? 14 HELX_P HELX_P2 2 LYS A 80 ? MET A 87 ? LYS A 80 MET A 87 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 39 ? ILE A 43 ? MET A 39 ILE A 43 A 2 VAL A 27 ? ASN A 33 ? VAL A 27 ASN A 33 A 3 ASP A 90 ? MET A 96 ? ASP A 90 MET A 96 A 4 ARG A 68 ? LEU A 70 ? ARG A 68 LEU A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 41 ? O PHE A 41 N VAL A 29 ? N VAL A 29 A 2 3 N VAL A 32 ? N VAL A 32 O ALA A 95 ? O ALA A 95 A 3 4 O MET A 96 ? O MET A 96 N ARG A 68 ? N ARG A 68 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 3 ? ? -173.34 120.99 2 1 SER A 9 ? ? -176.35 59.13 3 1 GLU A 14 ? ? -64.42 -179.86 4 1 ALA A 16 ? ? 58.20 76.28 5 1 GLU A 17 ? ? -165.88 95.78 6 1 LYS A 21 ? ? -118.34 -74.30 7 1 GLU A 22 ? ? -177.73 -69.63 8 1 GLU A 23 ? ? 62.97 163.50 9 1 ALA A 48 ? ? -127.30 -53.61 10 1 SER A 63 ? ? -58.57 172.38 11 1 SER A 66 ? ? -179.14 35.40 12 1 PRO A 75 ? ? -69.76 95.93 13 1 GLN A 99 ? ? -172.87 144.86 14 2 GLU A 22 ? ? -153.35 -56.02 15 2 THR A 47 ? ? -164.21 95.33 16 2 ALA A 48 ? ? -128.85 -54.20 17 2 SER A 63 ? ? -58.60 172.52 18 2 ASN A 65 ? ? -143.92 37.65 19 2 SER A 66 ? ? -158.40 23.79 20 2 PRO A 75 ? ? -69.78 97.54 21 2 GLU A 98 ? ? -95.03 51.58 22 2 GLN A 99 ? ? 56.85 71.47 23 2 THR A 100 ? ? -170.79 31.46 24 3 SER A 2 ? ? -153.08 66.88 25 3 ASN A 11 ? ? 57.20 92.03 26 3 ALA A 16 ? ? -102.90 69.35 27 3 CYS A 20 ? ? -151.22 57.11 28 3 ALA A 48 ? ? -152.49 -61.46 29 3 SER A 63 ? ? -58.47 172.62 30 3 SER A 66 ? ? -174.75 35.22 31 3 PRO A 75 ? ? -69.77 90.61 32 3 LYS A 80 ? ? -121.28 -52.16 33 3 GLN A 99 ? ? 61.15 169.40 34 4 SER A 2 ? ? -171.35 147.65 35 4 ASN A 4 ? ? -129.88 -73.90 36 4 PRO A 8 ? ? -69.74 -172.69 37 4 SER A 9 ? ? -160.23 70.70 38 4 ASN A 11 ? ? -147.81 -44.55 39 4 ALA A 16 ? ? -177.93 140.70 40 4 GLU A 17 ? ? -170.18 -176.73 41 4 THR A 19 ? ? -160.31 100.61 42 4 GLU A 22 ? ? -176.82 -170.76 43 4 GLU A 23 ? ? 62.14 172.34 44 4 ALA A 48 ? ? -138.00 -64.80 45 4 SER A 63 ? ? -58.18 170.22 46 4 ASN A 65 ? ? -147.48 54.26 47 4 SER A 66 ? ? -176.89 33.12 48 4 PRO A 75 ? ? -69.77 98.37 49 4 GLU A 78 ? ? 179.35 170.59 50 4 LYS A 80 ? ? -120.24 -57.18 51 4 GLN A 99 ? ? 58.31 94.37 52 5 ASN A 3 ? ? -178.29 131.51 53 5 PRO A 8 ? ? -69.77 -177.65 54 5 ASN A 11 ? ? -157.80 41.01 55 5 GLU A 14 ? ? 58.07 178.43 56 5 GLU A 22 ? ? -74.44 -169.98 57 5 ALA A 48 ? ? -149.41 -61.14 58 5 SER A 63 ? ? -58.44 172.33 59 5 SER A 66 ? ? -161.06 31.26 60 5 PRO A 75 ? ? -69.75 96.96 61 5 LYS A 80 ? ? -137.35 -40.27 62 5 GLN A 99 ? ? 62.96 -178.40 63 6 SER A 2 ? ? -178.81 102.97 64 6 ASN A 11 ? ? 58.37 85.50 65 6 ALA A 16 ? ? -149.55 32.21 66 6 THR A 19 ? ? -114.98 75.18 67 6 CYS A 20 ? ? 57.94 -176.61 68 6 LYS A 21 ? ? 56.15 -174.44 69 6 ALA A 48 ? ? -160.20 -57.66 70 6 SER A 63 ? ? -58.20 172.82 71 6 SER A 66 ? ? -154.46 23.65 72 6 PRO A 75 ? ? -69.78 97.22 73 6 GLU A 98 ? ? -148.30 28.22 74 7 SER A 9 ? ? -166.94 118.93 75 7 ASN A 10 ? ? -86.49 -70.27 76 7 ASN A 11 ? ? 59.13 95.53 77 7 GLU A 14 ? ? 58.90 -177.86 78 7 THR A 19 ? ? -132.71 -67.36 79 7 CYS A 20 ? ? 55.27 86.23 80 7 GLU A 22 ? ? 60.31 73.61 81 7 ALA A 48 ? ? -154.31 -58.59 82 7 SER A 63 ? ? -58.34 172.68 83 7 SER A 66 ? ? -163.61 28.77 84 8 SER A 9 ? ? -128.25 -53.50 85 8 ASN A 10 ? ? 59.46 -179.15 86 8 ASN A 11 ? ? 54.42 86.46 87 8 ALA A 16 ? ? 57.34 87.95 88 8 THR A 19 ? ? -167.33 31.67 89 8 GLU A 23 ? ? 58.83 -178.81 90 8 THR A 47 ? ? -178.26 104.70 91 8 ALA A 48 ? ? -151.15 -70.69 92 8 SER A 63 ? ? -58.03 172.87 93 8 SER A 66 ? ? -154.68 28.65 94 8 LYS A 80 ? ? -124.35 -50.52 95 8 MET A 87 ? ? -177.86 -173.99 96 8 ASP A 89 ? ? 72.16 -70.26 97 8 GLU A 98 ? ? -160.91 100.53 98 8 GLN A 99 ? ? 62.42 166.47 99 9 ASN A 3 ? ? -174.89 128.86 100 9 SER A 9 ? ? -163.14 89.37 101 9 ASN A 11 ? ? 61.95 99.67 102 9 THR A 19 ? ? -148.77 33.01 103 9 ALA A 25 ? ? -164.88 115.12 104 9 ALA A 48 ? ? -151.45 -59.16 105 9 SER A 63 ? ? -58.47 172.46 106 9 SER A 66 ? ? -163.80 33.26 107 9 PRO A 75 ? ? -69.75 95.56 108 9 GLU A 78 ? ? 179.04 174.02 109 9 LYS A 80 ? ? -128.78 -52.78 110 10 ASN A 11 ? ? 62.55 172.60 111 10 GLU A 14 ? ? 57.12 70.31 112 10 CYS A 20 ? ? 58.54 -178.23 113 10 GLU A 23 ? ? -144.97 38.19 114 10 ALA A 48 ? ? -153.10 -68.05 115 10 SER A 63 ? ? -58.41 172.31 116 10 SER A 66 ? ? -160.14 25.35 117 10 PRO A 75 ? ? -69.74 97.32 118 11 ASN A 4 ? ? -111.17 70.35 119 11 SER A 9 ? ? -158.65 31.72 120 11 ASN A 11 ? ? 60.47 -178.08 121 11 GLU A 14 ? ? 61.83 173.06 122 11 GLU A 17 ? ? 61.65 171.91 123 11 GLU A 23 ? ? 62.77 -174.73 124 11 ALA A 48 ? ? -149.59 -67.62 125 11 SER A 63 ? ? -58.73 172.50 126 11 SER A 66 ? ? -176.15 33.29 127 11 PRO A 75 ? ? -69.76 93.89 128 11 GLU A 98 ? ? -117.37 56.18 129 12 SER A 2 ? ? -174.27 77.65 130 12 SER A 9 ? ? -134.50 -72.69 131 12 ASN A 10 ? ? -163.77 83.00 132 12 GLU A 14 ? ? -175.72 -62.22 133 12 ALA A 16 ? ? -176.15 143.03 134 12 LYS A 21 ? ? 53.66 87.74 135 12 GLU A 22 ? ? -112.95 -73.74 136 12 GLU A 23 ? ? -175.89 -172.23 137 12 ALA A 48 ? ? -152.48 -54.51 138 12 SER A 63 ? ? -58.47 172.51 139 12 SER A 66 ? ? -151.87 26.18 140 12 PRO A 75 ? ? -69.80 97.10 141 12 GLN A 99 ? ? -96.36 37.16 142 13 ASN A 3 ? ? -174.21 107.52 143 13 GLU A 14 ? ? 69.15 -75.61 144 13 THR A 19 ? ? 64.28 106.58 145 13 GLU A 22 ? ? -178.41 148.62 146 13 ALA A 48 ? ? -155.89 -61.92 147 13 SER A 63 ? ? -58.16 172.08 148 13 ASN A 65 ? ? -152.81 45.89 149 13 SER A 66 ? ? -154.65 21.43 150 13 PRO A 75 ? ? -69.79 99.64 151 13 LYS A 80 ? ? -140.68 -41.51 152 13 GLN A 99 ? ? 62.41 173.36 153 14 SER A 2 ? ? -146.48 40.62 154 14 ASN A 11 ? ? 63.21 174.47 155 14 GLU A 14 ? ? 71.58 -69.63 156 14 CYS A 20 ? ? -137.31 -41.96 157 14 GLU A 22 ? ? -174.55 77.12 158 14 GLU A 23 ? ? -176.42 -169.95 159 14 ALA A 48 ? ? -138.66 -63.93 160 14 SER A 63 ? ? -58.35 172.78 161 14 SER A 66 ? ? -155.48 28.02 162 14 GLU A 98 ? ? -173.17 37.14 163 15 SER A 9 ? ? -176.83 45.28 164 15 CYS A 20 ? ? 58.18 -177.19 165 15 LYS A 21 ? ? -171.27 122.92 166 15 GLU A 22 ? ? -108.67 64.23 167 15 ALA A 48 ? ? -172.70 -50.23 168 15 SER A 63 ? ? -58.31 172.43 169 15 SER A 66 ? ? -154.35 28.36 170 15 PRO A 75 ? ? -69.78 92.11 171 16 SER A 2 ? ? -174.31 145.20 172 16 SER A 9 ? ? -178.86 131.24 173 16 ASN A 11 ? ? 62.66 -175.82 174 16 ALA A 16 ? ? -171.60 -177.65 175 16 CYS A 20 ? ? 60.09 93.61 176 16 GLU A 22 ? ? -177.66 69.31 177 16 THR A 47 ? ? -179.96 83.42 178 16 ALA A 48 ? ? -132.54 -57.58 179 16 SER A 63 ? ? -58.01 172.76 180 16 SER A 66 ? ? -170.42 30.62 181 16 LYS A 80 ? ? -133.19 -59.47 182 16 MET A 87 ? ? -177.94 -174.69 183 16 ASP A 89 ? ? 71.83 -70.29 184 17 SER A 2 ? ? -55.22 -72.85 185 17 ASN A 3 ? ? 63.15 105.07 186 17 ASN A 10 ? ? -95.90 -65.16 187 17 ASN A 11 ? ? 62.07 95.94 188 17 ALA A 16 ? ? -178.10 131.94 189 17 THR A 19 ? ? 64.38 108.39 190 17 LYS A 21 ? ? -176.73 112.76 191 17 GLU A 22 ? ? -174.12 -169.75 192 17 GLU A 23 ? ? -61.15 -169.72 193 17 ALA A 48 ? ? -154.05 -73.24 194 17 SER A 63 ? ? -58.55 172.48 195 17 SER A 66 ? ? -171.56 36.92 196 17 PRO A 75 ? ? -69.78 94.18 197 18 ASN A 3 ? ? -168.94 116.52 198 18 SER A 9 ? ? -147.73 33.59 199 18 ASN A 11 ? ? -170.57 -175.48 200 18 CYS A 20 ? ? 61.16 -170.85 201 18 GLU A 23 ? ? 63.20 173.24 202 18 ALA A 48 ? ? -159.08 -68.86 203 18 SER A 63 ? ? -58.41 172.78 204 18 SER A 66 ? ? -167.99 35.30 205 18 PRO A 75 ? ? -69.76 94.44 206 18 GLN A 99 ? ? 55.39 -170.26 207 19 PRO A 8 ? ? -69.77 -171.02 208 19 SER A 9 ? ? -179.15 100.46 209 19 ASN A 11 ? ? -178.02 98.40 210 19 GLU A 14 ? ? 52.31 -170.14 211 19 ALA A 16 ? ? -178.23 146.58 212 19 GLU A 22 ? ? -172.17 128.86 213 19 GLU A 23 ? ? -178.33 -169.92 214 19 ALA A 48 ? ? -161.45 -59.54 215 19 SER A 63 ? ? -58.71 172.35 216 19 SER A 66 ? ? -152.54 24.10 217 19 PRO A 75 ? ? -69.73 98.52 218 19 GLU A 98 ? ? -115.23 64.70 219 19 THR A 100 ? ? 55.63 92.37 220 20 SER A 2 ? ? -160.28 83.28 221 20 ASN A 4 ? ? -132.05 -74.39 222 20 SER A 9 ? ? -170.56 137.54 223 20 ASN A 11 ? ? 52.66 88.66 224 20 ALA A 16 ? ? 63.71 166.80 225 20 GLU A 17 ? ? -140.92 -69.05 226 20 CYS A 20 ? ? -175.26 -72.24 227 20 LYS A 21 ? ? 61.92 93.04 228 20 GLU A 22 ? ? -179.17 -35.73 229 20 THR A 47 ? ? -160.40 81.25 230 20 ALA A 48 ? ? -122.73 -70.13 231 20 SER A 63 ? ? -57.89 172.28 232 20 ASN A 65 ? ? -147.54 44.38 233 20 SER A 66 ? ? -154.88 21.70 234 20 PRO A 75 ? ? -69.73 98.20 235 20 LYS A 80 ? ? -134.64 -39.38 236 20 MET A 87 ? ? 63.53 62.31 237 20 GLU A 98 ? ? -145.38 59.21 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K8H _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K8H _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '0.5-1.0mM [U-99% 13C; U-99% 15N] small ubiquitin-like modifier, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component 'small ubiquitin-like modifier' _pdbx_nmr_exptl_sample.concentration 0.5 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.2 _pdbx_nmr_exptl_sample_conditions.pH 6.25 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D CBCA(CO)NH' 1 2 1 '3D C(CO)NH' 1 3 1 '3D HNCO' 1 4 1 '3D HBHA(CO)NH' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '3D 1H-13C NOESY' 1 7 1 '3D HNCACB' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D HCCH-TOCSY' # _pdbx_nmr_refine.entry_id 2K8H _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler, Wuthrich' 'data analysis' CYANA ? 1 'Guntert, Mumenthaler, Wuthrich' refinement CYANA ? 2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 103 ? A LEU 103 2 1 Y 1 A GLU 104 ? A GLU 104 3 1 Y 1 A HIS 105 ? A HIS 105 4 1 Y 1 A HIS 106 ? A HIS 106 5 1 Y 1 A HIS 107 ? A HIS 107 6 1 Y 1 A HIS 108 ? A HIS 108 7 1 Y 1 A HIS 109 ? A HIS 109 8 1 Y 1 A HIS 110 ? A HIS 110 9 2 Y 1 A LEU 103 ? A LEU 103 10 2 Y 1 A GLU 104 ? A GLU 104 11 2 Y 1 A HIS 105 ? A HIS 105 12 2 Y 1 A HIS 106 ? A HIS 106 13 2 Y 1 A HIS 107 ? A HIS 107 14 2 Y 1 A HIS 108 ? A HIS 108 15 2 Y 1 A HIS 109 ? A HIS 109 16 2 Y 1 A HIS 110 ? A HIS 110 17 3 Y 1 A LEU 103 ? A LEU 103 18 3 Y 1 A GLU 104 ? A GLU 104 19 3 Y 1 A HIS 105 ? A HIS 105 20 3 Y 1 A HIS 106 ? A HIS 106 21 3 Y 1 A HIS 107 ? A HIS 107 22 3 Y 1 A HIS 108 ? A HIS 108 23 3 Y 1 A HIS 109 ? A HIS 109 24 3 Y 1 A HIS 110 ? A HIS 110 25 4 Y 1 A LEU 103 ? A LEU 103 26 4 Y 1 A GLU 104 ? A GLU 104 27 4 Y 1 A HIS 105 ? A HIS 105 28 4 Y 1 A HIS 106 ? A HIS 106 29 4 Y 1 A HIS 107 ? A HIS 107 30 4 Y 1 A HIS 108 ? A HIS 108 31 4 Y 1 A HIS 109 ? A HIS 109 32 4 Y 1 A HIS 110 ? A HIS 110 33 5 Y 1 A LEU 103 ? A LEU 103 34 5 Y 1 A GLU 104 ? A GLU 104 35 5 Y 1 A HIS 105 ? A HIS 105 36 5 Y 1 A HIS 106 ? A HIS 106 37 5 Y 1 A HIS 107 ? A HIS 107 38 5 Y 1 A HIS 108 ? A HIS 108 39 5 Y 1 A HIS 109 ? A HIS 109 40 5 Y 1 A HIS 110 ? A HIS 110 41 6 Y 1 A LEU 103 ? A LEU 103 42 6 Y 1 A GLU 104 ? A GLU 104 43 6 Y 1 A HIS 105 ? A HIS 105 44 6 Y 1 A HIS 106 ? A HIS 106 45 6 Y 1 A HIS 107 ? A HIS 107 46 6 Y 1 A HIS 108 ? A HIS 108 47 6 Y 1 A HIS 109 ? A HIS 109 48 6 Y 1 A HIS 110 ? A HIS 110 49 7 Y 1 A LEU 103 ? A LEU 103 50 7 Y 1 A GLU 104 ? A GLU 104 51 7 Y 1 A HIS 105 ? A HIS 105 52 7 Y 1 A HIS 106 ? A HIS 106 53 7 Y 1 A HIS 107 ? A HIS 107 54 7 Y 1 A HIS 108 ? A HIS 108 55 7 Y 1 A HIS 109 ? A HIS 109 56 7 Y 1 A HIS 110 ? A HIS 110 57 8 Y 1 A LEU 103 ? A LEU 103 58 8 Y 1 A GLU 104 ? A GLU 104 59 8 Y 1 A HIS 105 ? A HIS 105 60 8 Y 1 A HIS 106 ? A HIS 106 61 8 Y 1 A HIS 107 ? A HIS 107 62 8 Y 1 A HIS 108 ? A HIS 108 63 8 Y 1 A HIS 109 ? A HIS 109 64 8 Y 1 A HIS 110 ? A HIS 110 65 9 Y 1 A LEU 103 ? A LEU 103 66 9 Y 1 A GLU 104 ? A GLU 104 67 9 Y 1 A HIS 105 ? A HIS 105 68 9 Y 1 A HIS 106 ? A HIS 106 69 9 Y 1 A HIS 107 ? A HIS 107 70 9 Y 1 A HIS 108 ? A HIS 108 71 9 Y 1 A HIS 109 ? A HIS 109 72 9 Y 1 A HIS 110 ? A HIS 110 73 10 Y 1 A LEU 103 ? A LEU 103 74 10 Y 1 A GLU 104 ? A GLU 104 75 10 Y 1 A HIS 105 ? A HIS 105 76 10 Y 1 A HIS 106 ? A HIS 106 77 10 Y 1 A HIS 107 ? A HIS 107 78 10 Y 1 A HIS 108 ? A HIS 108 79 10 Y 1 A HIS 109 ? A HIS 109 80 10 Y 1 A HIS 110 ? A HIS 110 81 11 Y 1 A LEU 103 ? A LEU 103 82 11 Y 1 A GLU 104 ? A GLU 104 83 11 Y 1 A HIS 105 ? A HIS 105 84 11 Y 1 A HIS 106 ? A HIS 106 85 11 Y 1 A HIS 107 ? A HIS 107 86 11 Y 1 A HIS 108 ? A HIS 108 87 11 Y 1 A HIS 109 ? A HIS 109 88 11 Y 1 A HIS 110 ? A HIS 110 89 12 Y 1 A LEU 103 ? A LEU 103 90 12 Y 1 A GLU 104 ? A GLU 104 91 12 Y 1 A HIS 105 ? A HIS 105 92 12 Y 1 A HIS 106 ? A HIS 106 93 12 Y 1 A HIS 107 ? A HIS 107 94 12 Y 1 A HIS 108 ? A HIS 108 95 12 Y 1 A HIS 109 ? A HIS 109 96 12 Y 1 A HIS 110 ? A HIS 110 97 13 Y 1 A LEU 103 ? A LEU 103 98 13 Y 1 A GLU 104 ? A GLU 104 99 13 Y 1 A HIS 105 ? A HIS 105 100 13 Y 1 A HIS 106 ? A HIS 106 101 13 Y 1 A HIS 107 ? A HIS 107 102 13 Y 1 A HIS 108 ? A HIS 108 103 13 Y 1 A HIS 109 ? A HIS 109 104 13 Y 1 A HIS 110 ? A HIS 110 105 14 Y 1 A LEU 103 ? A LEU 103 106 14 Y 1 A GLU 104 ? A GLU 104 107 14 Y 1 A HIS 105 ? A HIS 105 108 14 Y 1 A HIS 106 ? A HIS 106 109 14 Y 1 A HIS 107 ? A HIS 107 110 14 Y 1 A HIS 108 ? A HIS 108 111 14 Y 1 A HIS 109 ? A HIS 109 112 14 Y 1 A HIS 110 ? A HIS 110 113 15 Y 1 A LEU 103 ? A LEU 103 114 15 Y 1 A GLU 104 ? A GLU 104 115 15 Y 1 A HIS 105 ? A HIS 105 116 15 Y 1 A HIS 106 ? A HIS 106 117 15 Y 1 A HIS 107 ? A HIS 107 118 15 Y 1 A HIS 108 ? A HIS 108 119 15 Y 1 A HIS 109 ? A HIS 109 120 15 Y 1 A HIS 110 ? A HIS 110 121 16 Y 1 A LEU 103 ? A LEU 103 122 16 Y 1 A GLU 104 ? A GLU 104 123 16 Y 1 A HIS 105 ? A HIS 105 124 16 Y 1 A HIS 106 ? A HIS 106 125 16 Y 1 A HIS 107 ? A HIS 107 126 16 Y 1 A HIS 108 ? A HIS 108 127 16 Y 1 A HIS 109 ? A HIS 109 128 16 Y 1 A HIS 110 ? A HIS 110 129 17 Y 1 A LEU 103 ? A LEU 103 130 17 Y 1 A GLU 104 ? A GLU 104 131 17 Y 1 A HIS 105 ? A HIS 105 132 17 Y 1 A HIS 106 ? A HIS 106 133 17 Y 1 A HIS 107 ? A HIS 107 134 17 Y 1 A HIS 108 ? A HIS 108 135 17 Y 1 A HIS 109 ? A HIS 109 136 17 Y 1 A HIS 110 ? A HIS 110 137 18 Y 1 A LEU 103 ? A LEU 103 138 18 Y 1 A GLU 104 ? A GLU 104 139 18 Y 1 A HIS 105 ? A HIS 105 140 18 Y 1 A HIS 106 ? A HIS 106 141 18 Y 1 A HIS 107 ? A HIS 107 142 18 Y 1 A HIS 108 ? A HIS 108 143 18 Y 1 A HIS 109 ? A HIS 109 144 18 Y 1 A HIS 110 ? A HIS 110 145 19 Y 1 A LEU 103 ? A LEU 103 146 19 Y 1 A GLU 104 ? A GLU 104 147 19 Y 1 A HIS 105 ? A HIS 105 148 19 Y 1 A HIS 106 ? A HIS 106 149 19 Y 1 A HIS 107 ? A HIS 107 150 19 Y 1 A HIS 108 ? A HIS 108 151 19 Y 1 A HIS 109 ? A HIS 109 152 19 Y 1 A HIS 110 ? A HIS 110 153 20 Y 1 A LEU 103 ? A LEU 103 154 20 Y 1 A GLU 104 ? A GLU 104 155 20 Y 1 A HIS 105 ? A HIS 105 156 20 Y 1 A HIS 106 ? A HIS 106 157 20 Y 1 A HIS 107 ? A HIS 107 158 20 Y 1 A HIS 108 ? A HIS 108 159 20 Y 1 A HIS 109 ? A HIS 109 160 20 Y 1 A HIS 110 ? A HIS 110 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DMX' # _atom_sites.entry_id 2K8H _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_