data_2K9E # _entry.id 2K9E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K9E pdb_00002k9e 10.2210/pdb2k9e/pdb RCSB RCSB100841 ? ? WWPDB D_1000100841 ? ? BMRB 15983 ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 15983 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K9E _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-10-09 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Galea, C.A.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Engineering a stable and selective peptide blocker of the Kv1.3 channel in T lymphocytes' _citation.journal_abbrev Mol.Pharmacol. _citation.journal_volume 75 _citation.page_first 762 _citation.page_last 773 _citation.year 2009 _citation.journal_id_ASTM MOPMA3 _citation.country US _citation.journal_id_ISSN 0026-895X _citation.journal_id_CSD 0197 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19122005 _citation.pdbx_database_id_DOI 10.1124/mol.108.052704 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pennington, M.W.' 1 ? primary 'Beeton, C.' 2 ? primary 'Galea, C.A.' 3 ? primary 'Smith, B.J.' 4 ? primary 'Chi, V.' 5 ? primary 'Monaghan, K.P.' 6 ? primary 'Garcia, A.' 7 ? primary 'Rangaraju, S.' 8 ? primary 'Giuffrida, A.' 9 ? primary 'Plank, D.' 10 ? primary 'Crossley, G.' 11 ? primary 'Nugent, D.' 12 ? primary 'Khaytin, I.' 13 ? primary 'Lefievre, Y.' 14 ? primary 'Peshenko, I.' 15 ? primary 'Dixon, C.' 16 ? primary 'Chauhan, S.' 17 ? primary 'Orzel, A.' 18 ? primary 'Inoue, T.' 19 ? primary 'Hu, X.' 20 ? primary 'Moore, R.V.' 21 ? primary 'Norton, R.S.' 22 ? primary 'Chandy, K.G.' 23 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description Kappa-stichotoxin-She3a _entity.formula_weight 4422.172 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'M21(NLE)' _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Kappa-SHTX-She3a,Potassium channel toxin ShK' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(ZV4)(PFX)RSCIDTIPKSRCTAFQCKHS(NLE)KYRLSFCRKTCGTC(NH2)' _entity_poly.pdbx_seq_one_letter_code_can FXRSCIDTIPKSRCTAFQCKHSLKYRLSFCRKTCGTCX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ZV4 n 1 2 PFX n 1 3 ARG n 1 4 SER n 1 5 CYS n 1 6 ILE n 1 7 ASP n 1 8 THR n 1 9 ILE n 1 10 PRO n 1 11 LYS n 1 12 SER n 1 13 ARG n 1 14 CYS n 1 15 THR n 1 16 ALA n 1 17 PHE n 1 18 GLN n 1 19 CYS n 1 20 LYS n 1 21 HIS n 1 22 SER n 1 23 NLE n 1 24 LYS n 1 25 TYR n 1 26 ARG n 1 27 LEU n 1 28 SER n 1 29 PHE n 1 30 CYS n 1 31 ARG n 1 32 LYS n 1 33 THR n 1 34 CYS n 1 35 GLY n 1 36 THR n 1 37 CYS n 1 38 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 38 _pdbx_entity_src_syn.organism_scientific 'Stichodactyla helianthus' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 6123 _pdbx_entity_src_syn.details 'The peptide was chemically synthesized. This sequence occurs naturally in Stichodactyla helianthus' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code K1A_STIHL _struct_ref.pdbx_db_accession P29187 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K9E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 37 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P29187 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 35 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 35 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K9E ZV4 A 1 ? UNP P29187 ? ? 'expression tag' -1 1 1 2K9E PFX A 2 ? UNP P29187 ? ? 'expression tag' 0 2 1 2K9E NLE A 23 ? UNP P29187 MET 21 'engineered mutation' 21 3 1 2K9E NH2 A 38 ? UNP P29187 ? ? amidation 36 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 NLE 'L-peptide linking' n NORLEUCINE ? 'C6 H13 N O2' 131.173 PFX peptide-like . '2-[2-(2-azanylethoxy)ethoxy]ethanoic acid' ? 'C6 H13 N O4' 163.172 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZV4 'L-peptide linking' n '(2S)-2-azanyl-3-(4-phosphonophenyl)propanoic acid' phosphophenylalanine 'C9 H12 N O5 P' 245.169 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '2D 1H-1H TOCSY' 2 4 2 '2D 1H-1H TOCSY' 2 5 2 '2D 1H-13C HSQC' 1 6 1 '2D 1H-1H COSY' 1 7 1 '2D 1H-1H NOESY' 2 8 2 '2D 1H-1H NOESY' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 10 4.79 ambient ? 293 K 2 10 4.1 ambient ? 278 K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '3.0 mM ShK-192, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '3.0 mM ShK-192, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker DRX 1 'Bruker DRX' 500 Bruker AMX 2 'Bruker AMX' # _pdbx_nmr_refine.entry_id 2K9E _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2K9E _pdbx_nmr_details.text 'THIS STRUCTURE WAS DETERMINED USING STANDARD 2D HOMONUCLEAR TECHNIQUES' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K9E _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 11 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K9E _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, Kuszewski, Tjandra and Clore' 'chemical shift assignment' 'X-PLOR NIH' ? 1 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K9E _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K9E _struct.title 'NMR Solution Structure for ShK-192: A Potent KV1.3-Specific Immunosuppressive Polypeptide' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K9E _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'Protein, Ionic channel inhibitor, Nematocyst, Neurotoxin, Potassium channel inhibitor, Secreted, Toxin' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 10 ? CYS A 14 ? PRO A 8 CYS A 12 5 ? 5 HELX_P HELX_P2 2 PHE A 17 ? SER A 22 ? PHE A 15 SER A 20 1 ? 6 HELX_P HELX_P3 3 SER A 22 ? LEU A 27 ? SER A 20 LEU A 25 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 3 A CYS 35 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 12 A CYS 28 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf3 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 17 A CYS 32 1_555 ? ? ? ? ? ? ? 2.017 ? ? covale1 covale both ? A ZV4 1 C ? ? ? 1_555 A PFX 2 N ? ? A ZV4 -1 A PFX 0 1_555 ? ? ? ? ? ? ? 1.328 sing ? covale2 covale both ? A PFX 2 C ? ? ? 1_555 A ARG 3 N ? ? A PFX 0 A ARG 1 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale3 covale both ? A SER 22 C ? ? ? 1_555 A NLE 23 N ? ? A SER 20 A NLE 21 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale4 covale both ? A NLE 23 C ? ? ? 1_555 A LYS 24 N ? ? A NLE 21 A LYS 22 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale5 covale both ? A CYS 37 C ? ? ? 1_555 A NH2 38 N ? ? A CYS 35 A NH2 36 1_555 ? ? ? ? ? ? ? 1.298 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _atom_sites.entry_id 2K9E _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ZV4 1 -1 0 ZV4 PFX A . n A 1 2 PFX 2 0 0 PFX PFX A . n A 1 3 ARG 3 1 1 ARG ARG A . n A 1 4 SER 4 2 2 SER SER A . n A 1 5 CYS 5 3 3 CYS CYS A . n A 1 6 ILE 6 4 4 ILE ILE A . n A 1 7 ASP 7 5 5 ASP ASP A . n A 1 8 THR 8 6 6 THR THR A . n A 1 9 ILE 9 7 7 ILE ILE A . n A 1 10 PRO 10 8 8 PRO PRO A . n A 1 11 LYS 11 9 9 LYS LYS A . n A 1 12 SER 12 10 10 SER SER A . n A 1 13 ARG 13 11 11 ARG ARG A . n A 1 14 CYS 14 12 12 CYS CYS A . n A 1 15 THR 15 13 13 THR THR A . n A 1 16 ALA 16 14 14 ALA ALA A . n A 1 17 PHE 17 15 15 PHE PHE A . n A 1 18 GLN 18 16 16 GLN GLN A . n A 1 19 CYS 19 17 17 CYS CYS A . n A 1 20 LYS 20 18 18 LYS LYS A . n A 1 21 HIS 21 19 19 HIS HIS A . n A 1 22 SER 22 20 20 SER SER A . n A 1 23 NLE 23 21 21 NLE NLE A . n A 1 24 LYS 24 22 22 LYS LYS A . n A 1 25 TYR 25 23 23 TYR TYR A . n A 1 26 ARG 26 24 24 ARG ARG A . n A 1 27 LEU 27 25 25 LEU LEU A . n A 1 28 SER 28 26 26 SER SER A . n A 1 29 PHE 29 27 27 PHE PHE A . n A 1 30 CYS 30 28 28 CYS CYS A . n A 1 31 ARG 31 29 29 ARG ARG A . n A 1 32 LYS 32 30 30 LYS LYS A . n A 1 33 THR 33 31 31 THR THR A . n A 1 34 CYS 34 32 32 CYS CYS A . n A 1 35 GLY 35 33 33 GLY GLY A . n A 1 36 THR 36 34 34 THR THR A . n A 1 37 CYS 37 35 35 CYS CYS A . n A 1 38 NH2 38 36 36 NH2 NH2 A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id NLE _pdbx_struct_mod_residue.label_seq_id 23 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id NLE _pdbx_struct_mod_residue.auth_seq_id 21 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LEU _pdbx_struct_mod_residue.details NORLEUCINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 110 ? 1 MORE 1 ? 1 'SSA (A^2)' 3320 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-01-20 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2021-11-10 5 'Structure model' 2 0 2023-04-19 6 'Structure model' 3 0 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 5 'Structure model' Advisory 8 5 'Structure model' 'Atomic model' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Derived calculations' 11 5 'Structure model' 'Experimental preparation' 12 5 'Structure model' 'Non-polymer description' 13 5 'Structure model' 'Polymer sequence' 14 5 'Structure model' 'Source and taxonomy' 15 5 'Structure model' 'Structure summary' 16 6 'Structure model' Advisory 17 6 'Structure model' 'Atomic model' 18 6 'Structure model' 'Data collection' 19 6 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_conn 7 4 'Structure model' database_2 8 4 'Structure model' struct_ref_seq_dif 9 5 'Structure model' atom_site 10 5 'Structure model' chem_comp 11 5 'Structure model' entity 12 5 'Structure model' entity_name_com 13 5 'Structure model' entity_poly 14 5 'Structure model' entity_poly_seq 15 5 'Structure model' pdbx_entity_src_syn 16 5 'Structure model' pdbx_nmr_sample_details 17 5 'Structure model' pdbx_poly_seq_scheme 18 5 'Structure model' pdbx_struct_assembly_prop 19 5 'Structure model' pdbx_struct_mod_residue 20 5 'Structure model' pdbx_validate_close_contact 21 5 'Structure model' struct_conf 22 5 'Structure model' struct_conn 23 5 'Structure model' struct_ref 24 5 'Structure model' struct_ref_seq 25 5 'Structure model' struct_ref_seq_dif 26 6 'Structure model' atom_site 27 6 'Structure model' chem_comp_atom 28 6 'Structure model' chem_comp_bond 29 6 'Structure model' pdbx_validate_close_contact 30 6 'Structure model' pdbx_validate_main_chain_plane 31 6 'Structure model' pdbx_validate_peptide_omega 32 6 'Structure model' pdbx_validate_rmsd_angle 33 6 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_struct_ref_seq_dif.details' 7 5 'Structure model' '_atom_site.Cartn_x' 8 5 'Structure model' '_atom_site.Cartn_y' 9 5 'Structure model' '_atom_site.Cartn_z' 10 5 'Structure model' '_atom_site.auth_atom_id' 11 5 'Structure model' '_atom_site.auth_comp_id' 12 5 'Structure model' '_atom_site.auth_seq_id' 13 5 'Structure model' '_atom_site.label_atom_id' 14 5 'Structure model' '_atom_site.label_comp_id' 15 5 'Structure model' '_atom_site.label_seq_id' 16 5 'Structure model' '_atom_site.type_symbol' 17 5 'Structure model' '_chem_comp.formula' 18 5 'Structure model' '_chem_comp.formula_weight' 19 5 'Structure model' '_chem_comp.name' 20 5 'Structure model' '_chem_comp.type' 21 5 'Structure model' '_entity.formula_weight' 22 5 'Structure model' '_entity.pdbx_description' 23 5 'Structure model' '_entity_name_com.name' 24 5 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 25 5 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 26 5 'Structure model' '_pdbx_entity_src_syn.organism_common_name' 27 5 'Structure model' '_pdbx_entity_src_syn.organism_scientific' 28 5 'Structure model' '_pdbx_entity_src_syn.pdbx_beg_seq_num' 29 5 'Structure model' '_pdbx_entity_src_syn.pdbx_end_seq_num' 30 5 'Structure model' '_pdbx_nmr_sample_details.contents' 31 5 'Structure model' '_pdbx_struct_mod_residue.label_seq_id' 32 5 'Structure model' '_struct_conf.beg_label_seq_id' 33 5 'Structure model' '_struct_conf.end_label_seq_id' 34 5 'Structure model' '_struct_ref.db_code' 35 5 'Structure model' '_struct_ref_seq.seq_align_beg' 36 5 'Structure model' '_struct_ref_seq.seq_align_end' 37 6 'Structure model' '_atom_site.Cartn_x' 38 6 'Structure model' '_atom_site.Cartn_y' 39 6 'Structure model' '_atom_site.Cartn_z' 40 6 'Structure model' '_atom_site.auth_atom_id' 41 6 'Structure model' '_atom_site.label_atom_id' 42 6 'Structure model' '_pdbx_validate_close_contact.auth_atom_id_1' 43 6 'Structure model' '_pdbx_validate_close_contact.auth_atom_id_2' 44 6 'Structure model' '_struct_conn.ptnr2_label_atom_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id ShK-192 3.0 mM ? 1 ShK-192 3.0 mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2K9E _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 639 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 187 _pdbx_nmr_constraints.NOE_long_range_total_count 112 _pdbx_nmr_constraints.NOE_medium_range_total_count 157 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 183 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A LYS 9 ? ? H A CYS 12 ? ? 1.58 2 3 HH21 A ARG 29 ? ? O A CYS 35 ? ? 1.57 3 4 O A ARG 1 ? ? HG A SER 2 ? ? 1.57 4 5 OD1 A ASP 5 ? ? O A SER 26 ? ? 2.18 5 5 OD2 A ASP 5 ? ? O A PHE 27 ? ? 2.19 6 6 OD2 A ASP 5 ? ? HZ2 A LYS 30 ? ? 1.55 7 7 O A ARG 24 ? ? OG1 A THR 34 ? ? 2.19 8 8 H A ZV4 -1 ? ? H A PFX 0 ? ? 1.24 9 8 O A PRO 8 ? ? N A SER 10 ? ? 2.07 10 12 HG A SER 20 ? ? HZ2 A LYS 22 ? ? 1.18 11 13 OD2 A ASP 5 ? ? HZ1 A LYS 30 ? ? 1.57 12 13 O A LYS 9 ? ? H A CYS 12 ? ? 1.60 13 15 O A TYR 23 ? ? H A CYS 28 ? ? 1.58 14 17 O A NLE 21 ? ? H A ARG 24 ? ? 1.55 15 17 OD1 A ASP 5 ? ? H A THR 6 ? ? 1.59 16 17 O A LYS 22 ? ? OG A SER 26 ? ? 2.15 17 19 O A LYS 30 ? ? H A GLY 33 ? ? 1.59 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 2 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 LYS _pdbx_validate_rmsd_bond.auth_seq_id_1 18 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 O _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 LYS _pdbx_validate_rmsd_bond.auth_seq_id_2 18 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.567 _pdbx_validate_rmsd_bond.bond_target_value 1.229 _pdbx_validate_rmsd_bond.bond_deviation 0.338 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.019 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 CA A PFX 0 ? ? C A PFX 0 ? ? N A ARG 1 ? ? 147.62 117.20 30.42 2.20 Y 2 2 CA A LYS 18 ? ? C A LYS 18 ? ? O A LYS 18 ? ? 149.62 120.10 29.52 2.10 N 3 2 O A LYS 18 ? ? C A LYS 18 ? ? N A HIS 19 ? ? 89.61 122.70 -33.09 1.60 Y 4 5 CA A PFX 0 ? ? C A PFX 0 ? ? N A ARG 1 ? ? 136.15 117.20 18.95 2.20 Y 5 10 CA A PFX 0 ? ? C A PFX 0 ? ? N A ARG 1 ? ? 99.32 117.20 -17.88 2.20 Y 6 14 CA A PFX 0 ? ? C A PFX 0 ? ? N A ARG 1 ? ? 134.55 117.20 17.35 2.20 Y 7 16 CA A PFX 0 ? ? C A PFX 0 ? ? N A ARG 1 ? ? 130.57 117.20 13.37 2.20 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -92.40 -153.53 2 1 PRO A 8 ? ? -44.48 106.55 3 1 LYS A 9 ? ? -37.84 -26.82 4 1 SER A 10 ? ? -63.21 2.16 5 1 ALA A 14 ? ? -55.94 -9.67 6 1 LYS A 22 ? ? -47.89 -18.32 7 1 LEU A 25 ? ? -161.72 29.17 8 1 SER A 26 ? ? -158.35 -57.35 9 1 ARG A 29 ? ? -92.66 44.67 10 1 LYS A 30 ? ? -177.36 -47.00 11 2 ARG A 1 ? ? -31.49 -94.67 12 2 SER A 2 ? ? 152.65 78.68 13 2 LYS A 9 ? ? -29.12 -30.71 14 2 SER A 10 ? ? -54.39 -0.70 15 2 ALA A 14 ? ? -58.32 -0.20 16 2 CYS A 17 ? ? -64.09 5.31 17 2 LYS A 22 ? ? -59.27 7.89 18 2 LEU A 25 ? ? -145.82 26.07 19 2 SER A 26 ? ? -151.96 -63.24 20 2 CYS A 28 ? ? -89.28 35.82 21 2 ARG A 29 ? ? -71.57 28.99 22 2 LYS A 30 ? ? -162.31 -47.48 23 2 CYS A 32 ? ? -65.57 20.45 24 3 ARG A 1 ? ? -85.67 -92.15 25 3 SER A 2 ? ? -151.72 18.55 26 3 THR A 6 ? ? -159.82 32.58 27 3 PRO A 8 ? ? -41.99 93.25 28 3 LYS A 9 ? ? -21.97 -41.81 29 3 SER A 10 ? ? -67.39 27.17 30 3 CYS A 17 ? ? -78.55 23.65 31 3 LYS A 18 ? ? -146.83 -35.19 32 3 LYS A 22 ? ? -55.91 5.04 33 3 LEU A 25 ? ? -140.27 11.20 34 3 SER A 26 ? ? -160.17 -56.52 35 3 CYS A 28 ? ? -91.81 36.73 36 3 ARG A 29 ? ? -62.52 9.67 37 3 LYS A 30 ? ? -139.82 -44.62 38 3 CYS A 32 ? ? -76.68 21.79 39 4 ARG A 1 ? ? 179.81 -68.44 40 4 SER A 2 ? ? 151.80 57.50 41 4 ILE A 4 ? ? -167.60 118.44 42 4 LYS A 9 ? ? -46.37 -16.93 43 4 SER A 10 ? ? -58.22 4.24 44 4 ALA A 14 ? ? -66.83 10.69 45 4 CYS A 17 ? ? -60.57 0.03 46 4 LYS A 22 ? ? -70.16 37.42 47 4 TYR A 23 ? ? -127.45 -50.08 48 4 LEU A 25 ? ? -173.70 35.50 49 4 SER A 26 ? ? -160.58 -67.70 50 4 LYS A 30 ? ? -151.51 -35.66 51 5 ARG A 1 ? ? -140.21 -150.50 52 5 SER A 2 ? ? -178.29 29.59 53 5 THR A 6 ? ? -143.48 15.10 54 5 ALA A 14 ? ? -63.71 13.12 55 5 SER A 26 ? ? -157.47 -54.57 56 5 ARG A 29 ? ? -77.40 39.10 57 5 LYS A 30 ? ? -172.77 -44.52 58 5 CYS A 32 ? ? -63.83 11.92 59 6 ARG A 1 ? ? 51.79 -125.08 60 6 LYS A 9 ? ? -33.96 -23.33 61 6 ALA A 14 ? ? -57.07 -8.66 62 6 LYS A 18 ? ? -139.47 -33.06 63 6 LYS A 22 ? ? -40.34 -15.81 64 6 ARG A 24 ? ? -77.08 24.69 65 6 LEU A 25 ? ? -178.88 32.44 66 6 SER A 26 ? ? -160.75 -70.06 67 6 CYS A 28 ? ? -101.43 64.52 68 6 ARG A 29 ? ? -73.76 36.50 69 6 LYS A 30 ? ? -176.98 -45.19 70 7 ARG A 1 ? ? -55.94 -89.10 71 7 ILE A 4 ? ? -170.82 131.08 72 7 LYS A 9 ? ? -61.45 1.55 73 7 ALA A 14 ? ? -63.91 12.36 74 7 LYS A 22 ? ? -54.46 6.96 75 7 LEU A 25 ? ? -157.59 27.44 76 7 SER A 26 ? ? -160.43 -61.12 77 7 PHE A 27 ? ? -94.80 -67.18 78 7 CYS A 28 ? ? -87.94 47.47 79 7 ARG A 29 ? ? -81.10 31.53 80 7 LYS A 30 ? ? -151.46 -44.75 81 8 SER A 2 ? ? 48.35 -174.91 82 8 PRO A 8 ? ? -65.74 66.16 83 8 LYS A 9 ? ? 12.02 -59.23 84 8 SER A 10 ? ? -54.67 5.68 85 8 LEU A 25 ? ? -166.86 39.11 86 8 SER A 26 ? ? -160.78 -54.59 87 8 CYS A 28 ? ? -110.57 61.62 88 8 ARG A 29 ? ? -72.61 25.74 89 8 LYS A 30 ? ? -161.75 -37.05 90 9 SER A 10 ? ? -69.07 10.44 91 9 CYS A 12 ? ? -69.22 98.59 92 9 ALA A 14 ? ? -50.82 -4.06 93 9 LYS A 22 ? ? -65.99 18.90 94 9 LEU A 25 ? ? -162.76 42.69 95 9 SER A 26 ? ? -161.17 -58.91 96 9 LYS A 30 ? ? -161.28 -34.65 97 10 ARG A 1 ? ? -70.89 -167.90 98 10 ALA A 14 ? ? -59.43 -6.53 99 10 LYS A 18 ? ? -130.19 -34.17 100 10 LEU A 25 ? ? -148.91 37.99 101 10 SER A 26 ? ? -160.97 -51.94 102 10 CYS A 28 ? ? -111.18 67.83 103 10 ARG A 29 ? ? -85.26 43.21 104 10 LYS A 30 ? ? -170.32 -47.63 105 10 CYS A 32 ? ? -67.22 9.51 106 11 ARG A 1 ? ? -158.38 -144.25 107 11 SER A 2 ? ? -158.75 77.05 108 11 THR A 6 ? ? -148.48 20.12 109 11 PRO A 8 ? ? -36.70 84.25 110 11 LYS A 9 ? ? -18.91 -43.24 111 11 SER A 10 ? ? -66.94 27.94 112 11 ARG A 24 ? ? -59.20 -8.28 113 11 LEU A 25 ? ? -151.13 32.37 114 11 SER A 26 ? ? -161.51 -57.08 115 11 ARG A 29 ? ? -77.54 33.87 116 11 LYS A 30 ? ? -178.66 -46.09 117 11 CYS A 32 ? ? -69.37 15.55 118 12 SER A 2 ? ? 173.12 31.66 119 12 ALA A 14 ? ? -59.29 -9.64 120 12 LYS A 18 ? ? -130.04 -36.59 121 12 LYS A 22 ? ? -57.78 3.55 122 12 LEU A 25 ? ? -153.15 37.37 123 12 SER A 26 ? ? -160.43 -55.58 124 12 CYS A 28 ? ? -104.66 68.56 125 12 LYS A 30 ? ? -138.48 -43.16 126 13 ARG A 1 ? ? -58.70 76.80 127 13 THR A 6 ? ? -142.80 28.36 128 13 PRO A 8 ? ? -49.56 85.05 129 13 LYS A 9 ? ? -11.80 -50.29 130 13 SER A 10 ? ? -49.47 0.03 131 13 CYS A 17 ? ? -71.22 25.72 132 13 LYS A 18 ? ? -164.08 -18.53 133 13 NLE A 21 ? ? -15.62 -48.83 134 13 LYS A 22 ? ? -70.98 32.77 135 13 LEU A 25 ? ? -143.43 51.70 136 13 SER A 26 ? ? -161.46 -60.09 137 13 LYS A 30 ? ? -135.96 -46.44 138 13 CYS A 32 ? ? -53.19 -2.76 139 14 ARG A 1 ? ? 41.60 73.39 140 14 PRO A 8 ? ? -54.60 105.45 141 14 LYS A 9 ? ? -33.35 -25.33 142 14 SER A 10 ? ? -66.24 18.59 143 14 ALA A 14 ? ? -58.17 -7.62 144 14 LEU A 25 ? ? -170.17 31.86 145 14 SER A 26 ? ? -159.92 -62.50 146 14 ARG A 29 ? ? -68.64 36.08 147 14 LYS A 30 ? ? -166.69 -49.90 148 14 CYS A 32 ? ? -61.32 3.35 149 15 ARG A 1 ? ? 48.85 77.74 150 15 SER A 2 ? ? -153.39 -30.48 151 15 THR A 6 ? ? -153.96 15.08 152 15 LYS A 18 ? ? -135.19 -36.10 153 15 LYS A 22 ? ? -60.89 7.12 154 15 LEU A 25 ? ? -147.21 15.42 155 15 SER A 26 ? ? -152.90 -65.64 156 15 LYS A 30 ? ? -146.51 -38.07 157 15 CYS A 32 ? ? -63.28 13.76 158 16 ARG A 1 ? ? -66.12 -161.08 159 16 SER A 2 ? ? 66.17 -12.75 160 16 LYS A 9 ? ? -63.25 5.03 161 16 ALA A 14 ? ? -64.27 11.55 162 16 LYS A 22 ? ? -47.63 -4.38 163 16 LEU A 25 ? ? -176.12 43.46 164 16 SER A 26 ? ? -161.24 -66.01 165 16 PHE A 27 ? ? -100.91 -62.21 166 16 CYS A 28 ? ? -82.13 47.35 167 16 LYS A 30 ? ? -131.85 -38.18 168 17 SER A 2 ? ? -58.98 -164.74 169 17 CYS A 3 ? ? -110.05 67.13 170 17 LYS A 9 ? ? -44.22 -17.41 171 17 ALA A 14 ? ? -59.30 0.94 172 17 LYS A 22 ? ? -37.65 -27.12 173 17 LEU A 25 ? ? -155.58 44.92 174 17 SER A 26 ? ? -160.28 -64.77 175 17 LYS A 30 ? ? -153.24 -36.01 176 17 CYS A 32 ? ? -64.06 5.71 177 18 ARG A 1 ? ? 28.82 74.05 178 18 THR A 6 ? ? -142.03 10.79 179 18 PRO A 8 ? ? -58.75 100.26 180 18 LYS A 9 ? ? -45.23 -9.61 181 18 ALA A 14 ? ? -63.16 4.95 182 18 LYS A 18 ? ? -138.52 -36.16 183 18 LYS A 22 ? ? -67.30 25.04 184 18 LEU A 25 ? ? -161.30 45.14 185 18 SER A 26 ? ? -156.22 -58.84 186 18 ARG A 29 ? ? -66.97 6.90 187 18 LYS A 30 ? ? -153.25 -41.66 188 19 SER A 2 ? ? -88.52 36.81 189 19 CYS A 3 ? ? -160.66 71.64 190 19 LYS A 9 ? ? -51.66 -0.55 191 19 ALA A 14 ? ? -62.41 1.65 192 19 CYS A 17 ? ? -76.63 21.60 193 19 LYS A 18 ? ? -139.10 -35.57 194 19 LYS A 22 ? ? -68.38 30.25 195 19 LEU A 25 ? ? -162.41 29.98 196 19 SER A 26 ? ? -160.53 -62.91 197 19 CYS A 28 ? ? -112.55 53.16 198 19 ARG A 29 ? ? -72.30 34.33 199 19 LYS A 30 ? ? -175.19 -47.43 200 20 SER A 2 ? ? 179.44 47.72 201 20 CYS A 3 ? ? -149.67 23.17 202 20 ALA A 14 ? ? -52.31 -3.73 203 20 LYS A 22 ? ? -94.46 37.88 204 20 SER A 26 ? ? -160.34 -69.00 205 20 CYS A 28 ? ? -95.40 50.76 206 20 LYS A 30 ? ? -149.67 -47.64 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ZV4 A -1 ? ? PFX A 0 ? ? 146.40 2 2 ZV4 A -1 ? ? PFX A 0 ? ? -136.40 3 3 ZV4 A -1 ? ? PFX A 0 ? ? 63.03 4 4 ZV4 A -1 ? ? PFX A 0 ? ? 101.41 5 5 ZV4 A -1 ? ? PFX A 0 ? ? -67.06 6 7 ZV4 A -1 ? ? PFX A 0 ? ? -130.08 7 10 ZV4 A -1 ? ? PFX A 0 ? ? -127.92 8 11 ZV4 A -1 ? ? PFX A 0 ? ? -82.05 9 12 ZV4 A -1 ? ? PFX A 0 ? ? -102.12 10 13 ZV4 A -1 ? ? PFX A 0 ? ? -116.46 11 15 ZV4 A -1 ? ? PFX A 0 ? ? -127.48 12 17 ZV4 A -1 ? ? PFX A 0 ? ? -145.95 13 19 ZV4 A -1 ? ? PFX A 0 ? ? -100.33 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 2 PFX A 0 ? ? -12.19 2 2 LYS A 18 ? ? -12.59 3 4 PFX A 0 ? ? -11.50 4 5 PFX A 0 ? ? -11.45 5 9 PFX A 0 ? ? -10.12 6 11 PFX A 0 ? ? -11.38 7 16 PFX A 0 ? ? -14.46 8 17 PFX A 0 ? ? 11.10 9 20 PFX A 0 ? ? -10.13 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLY N N N N 91 GLY CA C N N 92 GLY C C N N 93 GLY O O N N 94 GLY OXT O N N 95 GLY H H N N 96 GLY H2 H N N 97 GLY HA2 H N N 98 GLY HA3 H N N 99 GLY HXT H N N 100 HIS N N N N 101 HIS CA C N S 102 HIS C C N N 103 HIS O O N N 104 HIS CB C N N 105 HIS CG C Y N 106 HIS ND1 N Y N 107 HIS CD2 C Y N 108 HIS CE1 C Y N 109 HIS NE2 N Y N 110 HIS OXT O N N 111 HIS H H N N 112 HIS H2 H N N 113 HIS HA H N N 114 HIS HB2 H N N 115 HIS HB3 H N N 116 HIS HD1 H N N 117 HIS HD2 H N N 118 HIS HE1 H N N 119 HIS HE2 H N N 120 HIS HXT H N N 121 ILE N N N N 122 ILE CA C N S 123 ILE C C N N 124 ILE O O N N 125 ILE CB C N S 126 ILE CG1 C N N 127 ILE CG2 C N N 128 ILE CD1 C N N 129 ILE OXT O N N 130 ILE H H N N 131 ILE H2 H N N 132 ILE HA H N N 133 ILE HB H N N 134 ILE HG12 H N N 135 ILE HG13 H N N 136 ILE HG21 H N N 137 ILE HG22 H N N 138 ILE HG23 H N N 139 ILE HD11 H N N 140 ILE HD12 H N N 141 ILE HD13 H N N 142 ILE HXT H N N 143 LEU N N N N 144 LEU CA C N S 145 LEU C C N N 146 LEU O O N N 147 LEU CB C N N 148 LEU CG C N N 149 LEU CD1 C N N 150 LEU CD2 C N N 151 LEU OXT O N N 152 LEU H H N N 153 LEU H2 H N N 154 LEU HA H N N 155 LEU HB2 H N N 156 LEU HB3 H N N 157 LEU HG H N N 158 LEU HD11 H N N 159 LEU HD12 H N N 160 LEU HD13 H N N 161 LEU HD21 H N N 162 LEU HD22 H N N 163 LEU HD23 H N N 164 LEU HXT H N N 165 LYS N N N N 166 LYS CA C N S 167 LYS C C N N 168 LYS O O N N 169 LYS CB C N N 170 LYS CG C N N 171 LYS CD C N N 172 LYS CE C N N 173 LYS NZ N N N 174 LYS OXT O N N 175 LYS H H N N 176 LYS H2 H N N 177 LYS HA H N N 178 LYS HB2 H N N 179 LYS HB3 H N N 180 LYS HG2 H N N 181 LYS HG3 H N N 182 LYS HD2 H N N 183 LYS HD3 H N N 184 LYS HE2 H N N 185 LYS HE3 H N N 186 LYS HZ1 H N N 187 LYS HZ2 H N N 188 LYS HZ3 H N N 189 LYS HXT H N N 190 MET N N N N 191 MET CA C N S 192 MET C C N N 193 MET O O N N 194 MET CB C N N 195 MET CG C N N 196 MET SD S N N 197 MET CE C N N 198 MET OXT O N N 199 MET H H N N 200 MET H2 H N N 201 MET HA H N N 202 MET HB2 H N N 203 MET HB3 H N N 204 MET HG2 H N N 205 MET HG3 H N N 206 MET HE1 H N N 207 MET HE2 H N N 208 MET HE3 H N N 209 MET HXT H N N 210 NH2 N N N N 211 NH2 HN1 H N N 212 NH2 HN2 H N N 213 NLE N N N N 214 NLE CA C N S 215 NLE C C N N 216 NLE O O N N 217 NLE OXT O N N 218 NLE CB C N N 219 NLE CG C N N 220 NLE CD C N N 221 NLE CE C N N 222 NLE H H N N 223 NLE H2 H N N 224 NLE HA H N N 225 NLE HXT H N N 226 NLE HB2 H N N 227 NLE HB3 H N N 228 NLE HG2 H N N 229 NLE HG3 H N N 230 NLE HD2 H N N 231 NLE HD3 H N N 232 NLE HE1 H N N 233 NLE HE2 H N N 234 NLE HE3 H N N 235 PFX N N N N 236 PFX CA C N N 237 PFX C2 C N N 238 PFX O3 O N N 239 PFX C4 C N N 240 PFX C5 C N N 241 PFX O6 O N N 242 PFX C7 C N N 243 PFX C C N N 244 PFX O O N N 245 PFX H2 H N N 246 PFX H H N N 247 PFX HA1 H N N 248 PFX HA2 H N N 249 PFX H5 H N N 250 PFX H6 H N N 251 PFX H7 H N N 252 PFX H8 H N N 253 PFX H9 H N N 254 PFX H10 H N N 255 PFX H11 H N N 256 PFX H12 H N N 257 PFX OXT O N N 258 PFX HXT H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 SER N N N N 300 SER CA C N S 301 SER C C N N 302 SER O O N N 303 SER CB C N N 304 SER OG O N N 305 SER OXT O N N 306 SER H H N N 307 SER H2 H N N 308 SER HA H N N 309 SER HB2 H N N 310 SER HB3 H N N 311 SER HG H N N 312 SER HXT H N N 313 THR N N N N 314 THR CA C N S 315 THR C C N N 316 THR O O N N 317 THR CB C N R 318 THR OG1 O N N 319 THR CG2 C N N 320 THR OXT O N N 321 THR H H N N 322 THR H2 H N N 323 THR HA H N N 324 THR HB H N N 325 THR HG1 H N N 326 THR HG21 H N N 327 THR HG22 H N N 328 THR HG23 H N N 329 THR HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 ZV4 CA C N S 355 ZV4 N N N N 356 ZV4 CB C N N 357 ZV4 CG C Y N 358 ZV4 CD1 C Y N 359 ZV4 CD2 C Y N 360 ZV4 CE1 C Y N 361 ZV4 CE2 C Y N 362 ZV4 CZ C Y N 363 ZV4 PZ P N N 364 ZV4 O1P O N N 365 ZV4 O2P O N N 366 ZV4 O3P O N N 367 ZV4 C C N N 368 ZV4 O O N N 369 ZV4 HA H N N 370 ZV4 H H N N 371 ZV4 H2 H N N 372 ZV4 H2B H N N 373 ZV4 H1B H N N 374 ZV4 HD1 H N N 375 ZV4 HD2 H N N 376 ZV4 HE1 H N N 377 ZV4 HE2 H N N 378 ZV4 H11 H N N 379 ZV4 H12 H N N 380 ZV4 OXT O N N 381 ZV4 HXT H N N 382 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLY N CA sing N N 86 GLY N H sing N N 87 GLY N H2 sing N N 88 GLY CA C sing N N 89 GLY CA HA2 sing N N 90 GLY CA HA3 sing N N 91 GLY C O doub N N 92 GLY C OXT sing N N 93 GLY OXT HXT sing N N 94 HIS N CA sing N N 95 HIS N H sing N N 96 HIS N H2 sing N N 97 HIS CA C sing N N 98 HIS CA CB sing N N 99 HIS CA HA sing N N 100 HIS C O doub N N 101 HIS C OXT sing N N 102 HIS CB CG sing N N 103 HIS CB HB2 sing N N 104 HIS CB HB3 sing N N 105 HIS CG ND1 sing Y N 106 HIS CG CD2 doub Y N 107 HIS ND1 CE1 doub Y N 108 HIS ND1 HD1 sing N N 109 HIS CD2 NE2 sing Y N 110 HIS CD2 HD2 sing N N 111 HIS CE1 NE2 sing Y N 112 HIS CE1 HE1 sing N N 113 HIS NE2 HE2 sing N N 114 HIS OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 NH2 N HN1 sing N N 201 NH2 N HN2 sing N N 202 NLE N CA sing N N 203 NLE N H sing N N 204 NLE N H2 sing N N 205 NLE CA C sing N N 206 NLE CA CB sing N N 207 NLE CA HA sing N N 208 NLE C O doub N N 209 NLE C OXT sing N N 210 NLE OXT HXT sing N N 211 NLE CB CG sing N N 212 NLE CB HB2 sing N N 213 NLE CB HB3 sing N N 214 NLE CG CD sing N N 215 NLE CG HG2 sing N N 216 NLE CG HG3 sing N N 217 NLE CD CE sing N N 218 NLE CD HD2 sing N N 219 NLE CD HD3 sing N N 220 NLE CE HE1 sing N N 221 NLE CE HE2 sing N N 222 NLE CE HE3 sing N N 223 PFX N CA sing N N 224 PFX CA C2 sing N N 225 PFX C2 O3 sing N N 226 PFX O3 C4 sing N N 227 PFX C4 C5 sing N N 228 PFX C7 O6 sing N N 229 PFX C7 C sing N N 230 PFX C5 O6 sing N N 231 PFX O C doub N N 232 PFX N H2 sing N N 233 PFX N H sing N N 234 PFX CA HA1 sing N N 235 PFX CA HA2 sing N N 236 PFX C2 H5 sing N N 237 PFX C2 H6 sing N N 238 PFX C4 H7 sing N N 239 PFX C4 H8 sing N N 240 PFX C5 H9 sing N N 241 PFX C5 H10 sing N N 242 PFX C7 H11 sing N N 243 PFX C7 H12 sing N N 244 PFX C OXT sing N N 245 PFX OXT HXT sing N N 246 PHE N CA sing N N 247 PHE N H sing N N 248 PHE N H2 sing N N 249 PHE CA C sing N N 250 PHE CA CB sing N N 251 PHE CA HA sing N N 252 PHE C O doub N N 253 PHE C OXT sing N N 254 PHE CB CG sing N N 255 PHE CB HB2 sing N N 256 PHE CB HB3 sing N N 257 PHE CG CD1 doub Y N 258 PHE CG CD2 sing Y N 259 PHE CD1 CE1 sing Y N 260 PHE CD1 HD1 sing N N 261 PHE CD2 CE2 doub Y N 262 PHE CD2 HD2 sing N N 263 PHE CE1 CZ doub Y N 264 PHE CE1 HE1 sing N N 265 PHE CE2 CZ sing Y N 266 PHE CE2 HE2 sing N N 267 PHE CZ HZ sing N N 268 PHE OXT HXT sing N N 269 PRO N CA sing N N 270 PRO N CD sing N N 271 PRO N H sing N N 272 PRO CA C sing N N 273 PRO CA CB sing N N 274 PRO CA HA sing N N 275 PRO C O doub N N 276 PRO C OXT sing N N 277 PRO CB CG sing N N 278 PRO CB HB2 sing N N 279 PRO CB HB3 sing N N 280 PRO CG CD sing N N 281 PRO CG HG2 sing N N 282 PRO CG HG3 sing N N 283 PRO CD HD2 sing N N 284 PRO CD HD3 sing N N 285 PRO OXT HXT sing N N 286 SER N CA sing N N 287 SER N H sing N N 288 SER N H2 sing N N 289 SER CA C sing N N 290 SER CA CB sing N N 291 SER CA HA sing N N 292 SER C O doub N N 293 SER C OXT sing N N 294 SER CB OG sing N N 295 SER CB HB2 sing N N 296 SER CB HB3 sing N N 297 SER OG HG sing N N 298 SER OXT HXT sing N N 299 THR N CA sing N N 300 THR N H sing N N 301 THR N H2 sing N N 302 THR CA C sing N N 303 THR CA CB sing N N 304 THR CA HA sing N N 305 THR C O doub N N 306 THR C OXT sing N N 307 THR CB OG1 sing N N 308 THR CB CG2 sing N N 309 THR CB HB sing N N 310 THR OG1 HG1 sing N N 311 THR CG2 HG21 sing N N 312 THR CG2 HG22 sing N N 313 THR CG2 HG23 sing N N 314 THR OXT HXT sing N N 315 TYR N CA sing N N 316 TYR N H sing N N 317 TYR N H2 sing N N 318 TYR CA C sing N N 319 TYR CA CB sing N N 320 TYR CA HA sing N N 321 TYR C O doub N N 322 TYR C OXT sing N N 323 TYR CB CG sing N N 324 TYR CB HB2 sing N N 325 TYR CB HB3 sing N N 326 TYR CG CD1 doub Y N 327 TYR CG CD2 sing Y N 328 TYR CD1 CE1 sing Y N 329 TYR CD1 HD1 sing N N 330 TYR CD2 CE2 doub Y N 331 TYR CD2 HD2 sing N N 332 TYR CE1 CZ doub Y N 333 TYR CE1 HE1 sing N N 334 TYR CE2 CZ sing Y N 335 TYR CE2 HE2 sing N N 336 TYR CZ OH sing N N 337 TYR OH HH sing N N 338 TYR OXT HXT sing N N 339 ZV4 CB CG sing N N 340 ZV4 CB CA sing N N 341 ZV4 CG CD1 doub Y N 342 ZV4 CG CD2 sing Y N 343 ZV4 N CA sing N N 344 ZV4 CD1 CE1 sing Y N 345 ZV4 CD2 CE2 doub Y N 346 ZV4 CA C sing N N 347 ZV4 CE1 CZ doub Y N 348 ZV4 O2P PZ doub N N 349 ZV4 CE2 CZ sing Y N 350 ZV4 CZ PZ sing N N 351 ZV4 C O doub N N 352 ZV4 PZ O3P sing N N 353 ZV4 PZ O1P sing N N 354 ZV4 CA HA sing N N 355 ZV4 N H sing N N 356 ZV4 N H2 sing N N 357 ZV4 CB H2B sing N N 358 ZV4 CB H1B sing N N 359 ZV4 CD1 HD1 sing N N 360 ZV4 CD2 HD2 sing N N 361 ZV4 CE1 HE1 sing N N 362 ZV4 CE2 HE2 sing N N 363 ZV4 O1P H11 sing N N 364 ZV4 O3P H12 sing N N 365 ZV4 C OXT sing N N 366 ZV4 OXT HXT sing N N 367 #