data_2K9P # _entry.id 2K9P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K9P pdb_00002k9p 10.2210/pdb2k9p/pdb RCSB RCSB100852 ? ? WWPDB D_1000100852 ? ? BMRB 15995 ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 15995 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K9P _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-10-21 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Neumoin, N.' 1 'Zerbe, O.' 2 'Naider, F.' 3 # _citation.id primary _citation.title 'Structure of a double transmembrane fragment of a G-protein-coupled receptor in micelles.' _citation.journal_abbrev Biophys.J. _citation.journal_volume 96 _citation.page_first 3187 _citation.page_last 3196 _citation.year 2009 _citation.journal_id_ASTM BIOJAU _citation.country US _citation.journal_id_ISSN 0006-3495 _citation.journal_id_CSD 0030 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19383463 _citation.pdbx_database_id_DOI 10.1016/j.bpj.2009.01.012 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Neumoin, A.' 1 ? primary 'Cohen, L.S.' 2 ? primary 'Arshava, B.' 3 ? primary 'Tantry, S.' 4 ? primary 'Becker, J.M.' 5 ? primary 'Zerbe, O.' 6 ? primary 'Naider, F.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Pheromone alpha factor receptor' _entity.formula_weight 8757.145 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'M54L, C59S, M69V, M71I' _entity.pdbx_fragment TM1-TM2 _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GNGSTITFDELQGLVNSTVTQAILFGVRSGAAALTLIVVWITSRSRKTPIFIINQVSLFLIILHSALYFKYLLSNYSSVT _entity_poly.pdbx_seq_one_letter_code_can GNGSTITFDELQGLVNSTVTQAILFGVRSGAAALTLIVVWITSRSRKTPIFIINQVSLFLIILHSALYFKYLLSNYSSVT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASN n 1 3 GLY n 1 4 SER n 1 5 THR n 1 6 ILE n 1 7 THR n 1 8 PHE n 1 9 ASP n 1 10 GLU n 1 11 LEU n 1 12 GLN n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 ASN n 1 17 SER n 1 18 THR n 1 19 VAL n 1 20 THR n 1 21 GLN n 1 22 ALA n 1 23 ILE n 1 24 LEU n 1 25 PHE n 1 26 GLY n 1 27 VAL n 1 28 ARG n 1 29 SER n 1 30 GLY n 1 31 ALA n 1 32 ALA n 1 33 ALA n 1 34 LEU n 1 35 THR n 1 36 LEU n 1 37 ILE n 1 38 VAL n 1 39 VAL n 1 40 TRP n 1 41 ILE n 1 42 THR n 1 43 SER n 1 44 ARG n 1 45 SER n 1 46 ARG n 1 47 LYS n 1 48 THR n 1 49 PRO n 1 50 ILE n 1 51 PHE n 1 52 ILE n 1 53 ILE n 1 54 ASN n 1 55 GLN n 1 56 VAL n 1 57 SER n 1 58 LEU n 1 59 PHE n 1 60 LEU n 1 61 ILE n 1 62 ILE n 1 63 LEU n 1 64 HIS n 1 65 SER n 1 66 ALA n 1 67 LEU n 1 68 TYR n 1 69 PHE n 1 70 LYS n 1 71 TYR n 1 72 LEU n 1 73 LEU n 1 74 SER n 1 75 ASN n 1 76 TYR n 1 77 SER n 1 78 SER n 1 79 VAL n 1 80 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name yeast _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'STE2, YFL026W' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant 'AI (arabinose induced)' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector pLC01 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'arabinose-induced E.coli vector, protein encoded as the delta-Trp fusion, cleaved by CNBr cleavage' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code STE2_YEAST _struct_ref.pdbx_db_accession P06842 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GNGSTITFDELQGLVNSTVTQAIMFGVRCGAAALTLIVMWMTSRSRKTPIFIINQVSLFLIILHSALYFKYLLSNYSSVT ; _struct_ref.pdbx_align_begin 31 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K9P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 80 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06842 _struct_ref_seq.db_align_beg 31 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 110 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 31 _struct_ref_seq.pdbx_auth_seq_align_end 110 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K9P LEU A 24 ? UNP P06842 MET 54 'engineered mutation' 54 1 1 2K9P SER A 29 ? UNP P06842 CYS 59 'engineered mutation' 59 2 1 2K9P VAL A 39 ? UNP P06842 MET 69 'engineered mutation' 69 3 1 2K9P ILE A 41 ? UNP P06842 MET 71 'engineered mutation' 71 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D HNCA' 1 5 1 '3D HNCACB' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D CBCA(CO)NH' 1 8 1 '3D HN(CO)CA' 1 9 1 '3D HN(CA)CO' 1 10 2 '3D 1H-15N NOESY' 1 11 3 '3D 1H-15N NOESY' 1 12 4 '3D 1H-13C NOESY' 1 13 5 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.4 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 320 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '200 mM LPPG, 20 mM Na-phosphate buffer, 0.4 mM [U-100% 13C; U-100% 15N] TM1-TM2 peptide, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '200 mM LPPG, 20 mM Na-phosphate buffer, 0.4 mM [U-100% 15N] TM1-TM2 peptide, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '200 mM LPPG, 20 mM Na-phosphate buffer, 0.4 mM [U-100% 15N; 80% 2H] TM1-TM2 peptide, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' '200 mM [>85% 2H] LPPG, 20 mM Na-phosphate buffer, 0.4 mM [U-100% 13C; U-100% 15N] TM1-TM2 peptide, 90% H2O/10% D2O' 4 '90% H2O/10% D2O' ;200 mM [>85% 2H] LPPG, 20 mM Na-phosphate buffer, 0.4 mM [U-100% 13C; U-100% 15N; >98% 2H; Me(Ile(Hd1),Leu(Hd),Val(Hg)) 1H] TM1-TM2 peptide, 100% D2O ; 5 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 700 Bruker AVANCE 1 'Bruker Avance' 900 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2K9P _pdbx_nmr_refine.method 'simulated annealing, TORSION ANGLE DYNAMICS' _pdbx_nmr_refine.details 'AMBER6 energy minimization in explicit solvent' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K9P _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K9P _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'P.GUNTERT ET AL.' refinement CYANA 3.0 1 'Bartels et al.' 'structure solution' XEASY 55 2 'Keller et al.' 'chemical shift assignment' CARA ? 3 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Structure of a fragment comprising TM1 and TM2 helices from the yeast Ste2p GPCR in LPPG micelles' _exptl.entry_id 2K9P _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K9P _struct.title 'Structure of TM1_TM2 in LPPG micelles' _struct.pdbx_model_details 'Structure of a fragment comprising TM1 and TM2 helices from the yeast Ste2p GPCR in LPPG micelles' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K9P _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text ;GPCR, micelle, structurral biology, fragment, G-protein coupled receptor, Glycoprotein, Membrane, Pheromone response, Phosphoprotein, Receptor, Transducer, Transmembrane, MEMBRANE PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 8 ? SER A 43 ? PHE A 38 SER A 73 1 ? 36 HELX_P HELX_P2 2 PRO A 49 ? SER A 77 ? PRO A 79 SER A 107 1 ? 29 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2K9P _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 31 31 GLY GLY A . n A 1 2 ASN 2 32 32 ASN ASN A . n A 1 3 GLY 3 33 33 GLY GLY A . n A 1 4 SER 4 34 34 SER SER A . n A 1 5 THR 5 35 35 THR THR A . n A 1 6 ILE 6 36 36 ILE ILE A . n A 1 7 THR 7 37 37 THR THR A . n A 1 8 PHE 8 38 38 PHE PHE A . n A 1 9 ASP 9 39 39 ASP ASP A . n A 1 10 GLU 10 40 40 GLU GLU A . n A 1 11 LEU 11 41 41 LEU LEU A . n A 1 12 GLN 12 42 42 GLN GLN A . n A 1 13 GLY 13 43 43 GLY GLY A . n A 1 14 LEU 14 44 44 LEU LEU A . n A 1 15 VAL 15 45 45 VAL VAL A . n A 1 16 ASN 16 46 46 ASN ASN A . n A 1 17 SER 17 47 47 SER SER A . n A 1 18 THR 18 48 48 THR THR A . n A 1 19 VAL 19 49 49 VAL VAL A . n A 1 20 THR 20 50 50 THR THR A . n A 1 21 GLN 21 51 51 GLN GLN A . n A 1 22 ALA 22 52 52 ALA ALA A . n A 1 23 ILE 23 53 53 ILE ILE A . n A 1 24 LEU 24 54 54 LEU LEU A . n A 1 25 PHE 25 55 55 PHE PHE A . n A 1 26 GLY 26 56 56 GLY GLY A . n A 1 27 VAL 27 57 57 VAL VAL A . n A 1 28 ARG 28 58 58 ARG ARG A . n A 1 29 SER 29 59 59 SER SER A . n A 1 30 GLY 30 60 60 GLY GLY A . n A 1 31 ALA 31 61 61 ALA ALA A . n A 1 32 ALA 32 62 62 ALA ALA A . n A 1 33 ALA 33 63 63 ALA ALA A . n A 1 34 LEU 34 64 64 LEU LEU A . n A 1 35 THR 35 65 65 THR THR A . n A 1 36 LEU 36 66 66 LEU LEU A . n A 1 37 ILE 37 67 67 ILE ILE A . n A 1 38 VAL 38 68 68 VAL VAL A . n A 1 39 VAL 39 69 69 VAL VAL A . n A 1 40 TRP 40 70 70 TRP TRP A . n A 1 41 ILE 41 71 71 ILE ILE A . n A 1 42 THR 42 72 72 THR THR A . n A 1 43 SER 43 73 73 SER SER A . n A 1 44 ARG 44 74 74 ARG ARG A . n A 1 45 SER 45 75 75 SER SER A . n A 1 46 ARG 46 76 76 ARG ARG A . n A 1 47 LYS 47 77 77 LYS LYS A . n A 1 48 THR 48 78 78 THR THR A . n A 1 49 PRO 49 79 79 PRO PRO A . n A 1 50 ILE 50 80 80 ILE ILE A . n A 1 51 PHE 51 81 81 PHE PHE A . n A 1 52 ILE 52 82 82 ILE ILE A . n A 1 53 ILE 53 83 83 ILE ILE A . n A 1 54 ASN 54 84 84 ASN ASN A . n A 1 55 GLN 55 85 85 GLN GLN A . n A 1 56 VAL 56 86 86 VAL VAL A . n A 1 57 SER 57 87 87 SER SER A . n A 1 58 LEU 58 88 88 LEU LEU A . n A 1 59 PHE 59 89 89 PHE PHE A . n A 1 60 LEU 60 90 90 LEU LEU A . n A 1 61 ILE 61 91 91 ILE ILE A . n A 1 62 ILE 62 92 92 ILE ILE A . n A 1 63 LEU 63 93 93 LEU LEU A . n A 1 64 HIS 64 94 94 HIS HIS A . n A 1 65 SER 65 95 95 SER SER A . n A 1 66 ALA 66 96 96 ALA ALA A . n A 1 67 LEU 67 97 97 LEU LEU A . n A 1 68 TYR 68 98 98 TYR TYR A . n A 1 69 PHE 69 99 99 PHE PHE A . n A 1 70 LYS 70 100 100 LYS LYS A . n A 1 71 TYR 71 101 101 TYR TYR A . n A 1 72 LEU 72 102 102 LEU LEU A . n A 1 73 LEU 73 103 103 LEU LEU A . n A 1 74 SER 74 104 104 SER SER A . n A 1 75 ASN 75 105 105 ASN ASN A . n A 1 76 TYR 76 106 106 TYR TYR A . n A 1 77 SER 77 107 107 SER SER A . n A 1 78 SER 78 108 108 SER SER A . n A 1 79 VAL 79 109 109 VAL VAL A . n A 1 80 THR 80 110 110 THR THR A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-05-05 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2020-10-21 5 'Structure model' 1 4 2021-10-20 6 'Structure model' 1 5 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Source and taxonomy' 6 5 'Structure model' 'Database references' 7 6 'Structure model' 'Database references' 8 6 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' entity_src_gen 5 5 'Structure model' database_2 6 5 'Structure model' struct_ref_seq_dif 7 6 'Structure model' pdbx_database_status 8 6 'Structure model' struct_ref # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_spectrometer.model' 3 4 'Structure model' '_entity_src_gen.host_org_species' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_struct_ref_seq_dif.details' 7 6 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 6 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id LPPG 200 mM ? 1 'Na-phosphate buffer' 20 mM ? 1 'TM1-TM2 peptide' 0.4 mM '[U-100% 13C; U-100% 15N]' 1 LPPG 200 mM ? 2 'Na-phosphate buffer' 20 mM ? 2 'TM1-TM2 peptide' 0.4 mM '[U-100% 15N]' 2 LPPG 200 mM ? 3 'Na-phosphate buffer' 20 mM ? 3 'TM1-TM2 peptide' 0.4 mM '[U-100% 15N; 80% 2H]' 3 LPPG 200 mM '[>85% 2H]' 4 'Na-phosphate buffer' 20 mM ? 4 'TM1-TM2 peptide' 0.4 mM '[U-100% 13C; U-100% 15N]' 4 LPPG 200 mM '[>85% 2H]' 5 'Na-phosphate buffer' 20 mM ? 5 'TM1-TM2 peptide' 0.4 mM '[U-100% 13C; U-100% 15N; >98% 2H; Me(Ile(Hd1),Leu(Hd),Val(Hg)) 1H]' 5 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2K9P _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1247 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 439 _pdbx_nmr_constraints.NOE_long_range_total_count 24 _pdbx_nmr_constraints.NOE_medium_range_total_count 406 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 378 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 14 O A ASN 46 ? ? HG A SER 47 ? ? 1.59 2 15 O A PHE 55 ? ? HG A SER 59 ? ? 1.58 3 19 O A LYS 100 ? ? HG A SER 104 ? ? 1.55 4 20 O A TYR 101 ? ? HG A SER 104 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 47 ? ? -136.34 -46.25 2 1 THR A 72 ? ? -102.85 -63.85 3 1 SER A 107 ? ? 176.30 141.71 4 2 SER A 47 ? ? -169.26 49.17 5 2 THR A 48 ? ? -132.27 -59.09 6 3 SER A 34 ? ? -54.35 100.29 7 3 SER A 47 ? ? -170.01 64.61 8 3 THR A 48 ? ? -148.02 -57.37 9 3 THR A 78 ? ? -111.21 78.78 10 3 SER A 108 ? ? -78.49 23.09 11 4 SER A 47 ? ? -159.51 34.90 12 4 THR A 48 ? ? -127.96 -59.80 13 4 SER A 107 ? ? -118.94 -167.38 14 5 SER A 47 ? ? -169.23 51.44 15 5 THR A 48 ? ? -133.92 -61.83 16 5 THR A 78 ? ? -114.67 78.06 17 6 SER A 47 ? ? -166.37 48.24 18 6 THR A 48 ? ? -131.02 -58.77 19 7 THR A 37 ? ? -59.89 173.45 20 7 SER A 47 ? ? -167.55 50.46 21 7 THR A 48 ? ? -132.17 -46.93 22 8 SER A 47 ? ? -157.06 42.43 23 8 THR A 48 ? ? -134.02 -61.80 24 9 THR A 35 ? ? 47.32 26.66 25 9 SER A 47 ? ? -153.46 49.08 26 9 THR A 48 ? ? -139.43 -58.47 27 9 THR A 72 ? ? -106.89 -63.79 28 9 ARG A 76 ? ? -56.47 94.25 29 9 LYS A 77 ? ? -124.87 -163.43 30 9 SER A 108 ? ? 59.58 13.57 31 10 ASN A 32 ? ? -170.22 -178.64 32 10 SER A 47 ? ? -145.63 -46.38 33 10 SER A 73 ? ? -101.91 54.44 34 10 ARG A 74 ? ? -41.18 87.58 35 10 SER A 75 ? ? -65.57 -74.93 36 10 ARG A 76 ? ? -149.54 -72.59 37 10 LYS A 77 ? ? 174.41 150.92 38 11 ASN A 32 ? ? -121.81 -63.17 39 11 SER A 47 ? ? -161.51 52.66 40 11 THR A 48 ? ? -139.71 -62.29 41 11 THR A 72 ? ? -107.72 -60.29 42 11 SER A 75 ? ? -50.30 -71.34 43 11 LYS A 77 ? ? -69.01 89.87 44 11 SER A 107 ? ? -49.85 94.27 45 12 SER A 47 ? ? -145.78 -40.93 46 12 THR A 48 ? ? -89.40 -76.71 47 12 THR A 72 ? ? -102.67 -64.54 48 13 THR A 35 ? ? 44.76 29.89 49 13 SER A 47 ? ? -155.52 61.34 50 13 THR A 48 ? ? -151.24 -57.91 51 13 SER A 107 ? ? -164.75 119.20 52 14 SER A 47 ? ? -162.14 52.20 53 14 THR A 48 ? ? -143.59 -57.08 54 15 SER A 47 ? ? -163.53 61.33 55 15 THR A 48 ? ? -149.51 -58.93 56 15 SER A 75 ? ? -48.65 -74.72 57 16 SER A 47 ? ? -148.53 38.59 58 16 THR A 48 ? ? -130.61 -62.24 59 16 ARG A 74 ? ? 57.12 74.62 60 17 SER A 47 ? ? -147.65 38.08 61 17 THR A 48 ? ? -129.89 -53.46 62 17 THR A 72 ? ? -100.74 -62.71 63 17 SER A 75 ? ? -45.26 -76.55 64 17 LYS A 77 ? ? -45.47 97.78 65 18 SER A 34 ? ? -100.99 75.41 66 18 SER A 47 ? ? -150.59 40.02 67 18 THR A 48 ? ? -131.82 -50.79 68 18 SER A 107 ? ? -104.95 76.89 69 19 SER A 34 ? ? -111.68 71.65 70 19 SER A 47 ? ? -159.76 43.62 71 19 THR A 48 ? ? -125.22 -66.51 72 19 THR A 72 ? ? -105.22 -62.52 73 19 LYS A 77 ? ? -176.96 -33.25 74 20 ASN A 32 ? ? -93.25 -71.60 75 20 SER A 34 ? ? -115.07 77.30 76 20 THR A 37 ? ? -64.32 -178.69 77 20 SER A 47 ? ? -158.36 46.91 78 20 THR A 48 ? ? -135.85 -58.42 79 20 SER A 75 ? ? -53.88 109.78 80 20 SER A 107 ? ? 174.53 132.64 #