data_2KA1 # _entry.id 2KA1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KA1 pdb_00002ka1 10.2210/pdb2ka1/pdb RCSB RCSB100864 ? ? WWPDB D_1000100864 ? ? BMRB 16012 ? 10.13018/BMR16012 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-06-23 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 6 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KA1 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-10-30 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2KA2 unspecified . BMRB 16012 unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sulistijo, E.S.' 1 'MacKenzie, K.R.' 2 # _citation.id primary _citation.title 'Structural basis for dimerization of the BNIP3 transmembrane domain' _citation.journal_abbrev Biochemistry _citation.journal_volume 48 _citation.page_first 5106 _citation.page_last 5120 _citation.year 2009 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19415897 _citation.pdbx_database_id_DOI 10.1021/bi802245u # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sulistijo, E.S.' 1 ? primary 'Mackenzie, K.R.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'BCL2/adenovirus E1B 19 kDa protein-interacting protein 3' _entity.formula_weight 3790.588 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'transmembrane domain, residues 154-188' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLT _entity_poly.pdbx_seq_one_letter_code_can GGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLT _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 ILE n 1 4 PHE n 1 5 SER n 1 6 ALA n 1 7 GLU n 1 8 PHE n 1 9 LEU n 1 10 LYS n 1 11 VAL n 1 12 PHE n 1 13 LEU n 1 14 PRO n 1 15 SER n 1 16 LEU n 1 17 LEU n 1 18 LEU n 1 19 SER n 1 20 HIS n 1 21 LEU n 1 22 LEU n 1 23 ALA n 1 24 ILE n 1 25 GLY n 1 26 LEU n 1 27 GLY n 1 28 ILE n 1 29 TYR n 1 30 ILE n 1 31 GLY n 1 32 ARG n 1 33 ARG n 1 34 LEU n 1 35 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BNIP3, NIP3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET3A _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 154 154 GLY GLY A . n A 1 2 GLY 2 155 155 GLY GLY A . n A 1 3 ILE 3 156 156 ILE ILE A . n A 1 4 PHE 4 157 157 PHE PHE A . n A 1 5 SER 5 158 158 SER SER A . n A 1 6 ALA 6 159 159 ALA ALA A . n A 1 7 GLU 7 160 160 GLU GLU A . n A 1 8 PHE 8 161 161 PHE PHE A . n A 1 9 LEU 9 162 162 LEU LEU A . n A 1 10 LYS 10 163 163 LYS LYS A . n A 1 11 VAL 11 164 164 VAL VAL A . n A 1 12 PHE 12 165 165 PHE PHE A . n A 1 13 LEU 13 166 166 LEU LEU A . n A 1 14 PRO 14 167 167 PRO PRO A . n A 1 15 SER 15 168 168 SER SER A . n A 1 16 LEU 16 169 169 LEU LEU A . n A 1 17 LEU 17 170 170 LEU LEU A . n A 1 18 LEU 18 171 171 LEU LEU A . n A 1 19 SER 19 172 172 SER SER A . n A 1 20 HIS 20 173 173 HIS HIS A . n A 1 21 LEU 21 174 174 LEU LEU A . n A 1 22 LEU 22 175 175 LEU LEU A . n A 1 23 ALA 23 176 176 ALA ALA A . n A 1 24 ILE 24 177 177 ILE ILE A . n A 1 25 GLY 25 178 178 GLY GLY A . n A 1 26 LEU 26 179 179 LEU LEU A . n A 1 27 GLY 27 180 180 GLY GLY A . n A 1 28 ILE 28 181 181 ILE ILE A . n A 1 29 TYR 29 182 182 TYR TYR A . n A 1 30 ILE 30 183 183 ILE ILE A . n A 1 31 GLY 31 184 184 GLY GLY A . n A 1 32 ARG 32 185 185 ARG ARG A . n A 1 33 ARG 33 186 186 ARG ARG A . n A 1 34 LEU 34 187 187 LEU LEU A . n A 1 35 THR 35 188 188 THR THR A . n B 1 1 GLY 1 154 154 GLY GLY B . n B 1 2 GLY 2 155 155 GLY GLY B . n B 1 3 ILE 3 156 156 ILE ILE B . n B 1 4 PHE 4 157 157 PHE PHE B . n B 1 5 SER 5 158 158 SER SER B . n B 1 6 ALA 6 159 159 ALA ALA B . n B 1 7 GLU 7 160 160 GLU GLU B . n B 1 8 PHE 8 161 161 PHE PHE B . n B 1 9 LEU 9 162 162 LEU LEU B . n B 1 10 LYS 10 163 163 LYS LYS B . n B 1 11 VAL 11 164 164 VAL VAL B . n B 1 12 PHE 12 165 165 PHE PHE B . n B 1 13 LEU 13 166 166 LEU LEU B . n B 1 14 PRO 14 167 167 PRO PRO B . n B 1 15 SER 15 168 168 SER SER B . n B 1 16 LEU 16 169 169 LEU LEU B . n B 1 17 LEU 17 170 170 LEU LEU B . n B 1 18 LEU 18 171 171 LEU LEU B . n B 1 19 SER 19 172 172 SER SER B . n B 1 20 HIS 20 173 173 HIS HIS B . n B 1 21 LEU 21 174 174 LEU LEU B . n B 1 22 LEU 22 175 175 LEU LEU B . n B 1 23 ALA 23 176 176 ALA ALA B . n B 1 24 ILE 24 177 177 ILE ILE B . n B 1 25 GLY 25 178 178 GLY GLY B . n B 1 26 LEU 26 179 179 LEU LEU B . n B 1 27 GLY 27 180 180 GLY GLY B . n B 1 28 ILE 28 181 181 ILE ILE B . n B 1 29 TYR 29 182 182 TYR TYR B . n B 1 30 ILE 30 183 183 ILE ILE B . n B 1 31 GLY 31 184 184 GLY GLY B . n B 1 32 ARG 32 185 185 ARG ARG B . n B 1 33 ARG 33 186 186 ARG ARG B . n B 1 34 LEU 34 187 187 LEU LEU B . n B 1 35 THR 35 188 188 THR THR B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KA1 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KA1 _struct.title 'Solution NMR structure of BNIP3 transmembrane peptide dimer in detergent micelles' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KA1 _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text ;integral membrane protein, membrane helix-helix interactions, bnip3, transmembrane domain, homodimer, membrane protein folding, Apoptosis, Host-virus interaction, Mitochondrion, Phosphoprotein, MEMBRANE PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BNIP3_HUMAN _struct_ref.pdbx_db_accession Q12983 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLT _struct_ref.pdbx_align_begin 154 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2KA1 A 1 ? 35 ? Q12983 154 ? 188 ? 154 188 2 1 2KA1 B 1 ? 35 ? Q12983 154 ? 188 ? 154 188 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 5 ? LYS A 10 ? SER A 158 LYS A 163 1 ? 6 HELX_P HELX_P2 2 PHE A 12 ? ARG A 33 ? PHE A 165 ARG A 186 1 ? 22 HELX_P HELX_P3 3 SER B 5 ? VAL B 11 ? SER B 158 VAL B 164 1 ? 7 HELX_P HELX_P4 4 PHE B 12 ? THR B 35 ? PHE B 165 THR B 188 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 158 ? ? 50.48 -87.68 2 1 ARG A 186 ? ? -105.05 46.23 3 1 PHE B 157 ? ? -77.37 -71.98 4 1 SER B 158 ? ? 59.73 -84.20 5 2 PHE A 157 ? ? -76.51 -85.78 6 2 SER A 158 ? ? 36.09 -90.06 7 2 PHE A 165 ? ? -135.32 -52.97 8 2 SER B 158 ? ? 47.95 -90.29 9 2 PHE B 165 ? ? -123.14 -56.20 10 3 PHE A 157 ? ? -77.13 -75.28 11 3 SER A 158 ? ? 46.62 -88.00 12 3 PHE A 165 ? ? -136.74 -56.48 13 3 ARG A 186 ? ? -113.02 50.50 14 3 PHE B 157 ? ? -75.60 -78.53 15 3 SER B 158 ? ? 67.07 -75.68 16 3 PHE B 165 ? ? -146.86 -45.84 17 4 SER A 158 ? ? 44.38 -89.88 18 4 PHE A 165 ? ? -102.50 -64.36 19 4 SER B 158 ? ? 46.05 -90.80 20 5 PHE A 157 ? ? -76.58 -74.72 21 5 SER A 158 ? ? 60.90 -84.27 22 5 PHE A 165 ? ? -131.63 -52.76 23 5 PHE B 165 ? ? -146.71 -45.07 24 6 SER A 158 ? ? 50.77 -86.37 25 6 PHE A 165 ? ? -139.59 -45.28 26 6 ARG A 186 ? ? -96.48 36.73 27 6 SER B 158 ? ? 40.92 -92.43 28 6 PHE B 165 ? ? -135.95 -58.99 29 7 SER A 158 ? ? 52.95 -86.35 30 7 PHE A 165 ? ? -132.75 -43.71 31 7 SER B 158 ? ? 44.26 -91.90 32 7 PHE B 165 ? ? -137.00 -43.39 33 8 PHE A 157 ? ? -76.79 -84.13 34 8 SER A 158 ? ? 71.44 -158.03 35 8 PHE A 165 ? ? -136.40 -62.23 36 8 SER B 158 ? ? 55.31 -85.83 37 8 PHE B 165 ? ? -148.18 -49.46 38 8 LEU B 187 ? ? -102.14 -67.50 39 9 PHE A 157 ? ? -76.53 -71.91 40 9 SER A 158 ? ? 56.17 -82.46 41 9 PHE A 165 ? ? -142.90 -60.66 42 9 ARG A 186 ? ? -101.15 44.78 43 9 PHE B 157 ? ? -157.85 -57.27 44 9 SER B 158 ? ? 38.47 -90.75 45 10 SER A 158 ? ? 43.66 -90.39 46 10 PHE A 165 ? ? -142.47 -50.94 47 10 SER B 158 ? ? 47.31 -90.35 48 11 PHE A 157 ? ? -75.96 -73.25 49 11 SER A 158 ? ? 43.01 -89.64 50 11 PHE A 165 ? ? -148.57 -45.37 51 11 PHE B 157 ? ? -77.14 -79.25 52 11 SER B 158 ? ? 61.06 134.54 53 11 ALA B 159 ? ? 89.81 -63.78 54 11 PHE B 165 ? ? -145.66 -50.19 55 12 PHE A 157 ? ? -76.86 -74.09 56 12 SER A 158 ? ? 48.40 -88.11 57 12 ARG A 186 ? ? -112.87 50.20 58 12 LEU A 187 ? ? -95.53 -68.47 59 12 SER B 158 ? ? 42.29 -89.90 60 12 PHE B 165 ? ? -145.94 -54.90 61 13 PHE A 157 ? ? -76.83 -76.73 62 13 SER A 158 ? ? 63.59 -78.96 63 13 SER B 158 ? ? 78.51 -163.60 64 13 PHE B 165 ? ? -139.74 -46.49 65 14 SER A 158 ? ? 40.45 -89.76 66 14 PHE A 165 ? ? -142.55 -49.03 67 14 ARG A 186 ? ? -96.01 37.68 68 14 SER B 158 ? ? -75.45 -100.34 69 14 GLU B 160 ? ? -53.27 -76.39 70 14 PHE B 165 ? ? -132.28 -46.21 71 15 PHE A 157 ? ? -156.44 -50.21 72 15 SER A 158 ? ? 49.89 -87.91 73 15 PHE A 165 ? ? -140.98 -51.94 74 15 SER B 158 ? ? 41.32 -92.47 75 15 PHE B 165 ? ? -122.69 -52.28 76 16 SER A 158 ? ? 43.55 -91.72 77 16 PHE A 165 ? ? -156.66 -44.93 78 16 ARG A 186 ? ? -99.11 37.36 79 16 PHE B 157 ? ? -77.04 -84.15 80 16 ALA B 159 ? ? -179.67 -62.67 81 16 PHE B 165 ? ? -146.63 -48.03 82 17 SER A 158 ? ? 51.44 -87.70 83 17 PHE A 165 ? ? -135.14 -60.57 84 17 SER B 158 ? ? 45.07 -90.88 85 17 PHE B 165 ? ? -128.98 -55.97 86 18 PHE A 157 ? ? -76.74 -79.69 87 18 SER A 158 ? ? 63.70 -76.21 88 18 PHE A 165 ? ? -148.02 -50.19 89 18 ARG A 186 ? ? -105.73 48.81 90 18 SER B 158 ? ? 43.92 -90.18 91 18 PHE B 165 ? ? -133.88 -53.76 92 19 PHE A 157 ? ? -77.22 -73.91 93 19 SER A 158 ? ? 38.46 -90.62 94 19 PHE A 165 ? ? -147.24 -48.28 95 19 ARG A 186 ? ? -95.13 41.73 96 19 SER B 158 ? ? 73.84 -163.49 97 19 VAL B 164 ? ? -96.41 31.95 98 19 PHE B 165 ? ? -144.88 -46.85 99 20 SER A 158 ? ? -167.77 -62.66 100 20 ALA A 159 ? ? 179.01 -53.13 101 20 PHE A 165 ? ? -138.01 -65.46 102 20 ARG A 186 ? ? -92.79 38.31 103 20 PHE B 157 ? ? -76.91 -71.70 104 20 SER B 158 ? ? 44.60 -90.38 105 20 PHE B 165 ? ? -143.41 -42.59 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KA1 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KA1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents ;0.4 mM [U-100% 13C; U-100% 15N] Bcl2/Adenovirus E1B 19 kDa protein-interacting protein 3, 0.6 mM Bcl2/Adenovirus E1B 19 kDa protein-interacting protein 3, 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Bcl2/Adenovirus E1B 19 kDa protein-interacting protein 3-1' 0.4 mM '[U-100% 13C; U-100% 15N]' 1 'Bcl2/Adenovirus E1B 19 kDa protein-interacting protein 3-2' 0.6 mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 5.1 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D CN-NOESY-HSQC' 1 2 1 '3D 15N-edited NOESY-HSQC' 1 3 1 '3D 13C-edited NOESY-HSQC optimized for aromatic carbon' 1 4 1 'half-filtered 3D CN-NOESY-HSQC' 1 5 1 '2D spin-echo difference CT HSQC' 1 6 1 HNHA 1 7 1 HNCA 1 8 1 CBCACONNH 1 9 1 HNCO 1 10 1 'H(C)CH-COSY' 1 11 1 '(H)CCH-TOCSY' 1 12 1 HBCBCGCDHD 1 13 1 HBCBCGCDCEHE # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KA1 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 58 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2034 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 1244 _pdbx_nmr_constraints.NOE_long_range_total_count 106 _pdbx_nmr_constraints.NOE_medium_range_total_count 228 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 384 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 22 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 8 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 34 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 34 # _pdbx_nmr_refine.entry_id 2KA1 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ;Linge, O'Donoghue and Nilges ; refinement ARIA 1.2 1 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 1.2 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRPipe ? 4 Goddard 'chemical shift assignment' Sparky ? 5 Goddard 'peak picking' Sparky ? 6 Varian collection VNMR ? 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 GLU N N N N 41 GLU CA C N S 42 GLU C C N N 43 GLU O O N N 44 GLU CB C N N 45 GLU CG C N N 46 GLU CD C N N 47 GLU OE1 O N N 48 GLU OE2 O N N 49 GLU OXT O N N 50 GLU H H N N 51 GLU H2 H N N 52 GLU HA H N N 53 GLU HB2 H N N 54 GLU HB3 H N N 55 GLU HG2 H N N 56 GLU HG3 H N N 57 GLU HE2 H N N 58 GLU HXT H N N 59 GLY N N N N 60 GLY CA C N N 61 GLY C C N N 62 GLY O O N N 63 GLY OXT O N N 64 GLY H H N N 65 GLY H2 H N N 66 GLY HA2 H N N 67 GLY HA3 H N N 68 GLY HXT H N N 69 HIS N N N N 70 HIS CA C N S 71 HIS C C N N 72 HIS O O N N 73 HIS CB C N N 74 HIS CG C Y N 75 HIS ND1 N Y N 76 HIS CD2 C Y N 77 HIS CE1 C Y N 78 HIS NE2 N Y N 79 HIS OXT O N N 80 HIS H H N N 81 HIS H2 H N N 82 HIS HA H N N 83 HIS HB2 H N N 84 HIS HB3 H N N 85 HIS HD1 H N N 86 HIS HD2 H N N 87 HIS HE1 H N N 88 HIS HE2 H N N 89 HIS HXT H N N 90 ILE N N N N 91 ILE CA C N S 92 ILE C C N N 93 ILE O O N N 94 ILE CB C N S 95 ILE CG1 C N N 96 ILE CG2 C N N 97 ILE CD1 C N N 98 ILE OXT O N N 99 ILE H H N N 100 ILE H2 H N N 101 ILE HA H N N 102 ILE HB H N N 103 ILE HG12 H N N 104 ILE HG13 H N N 105 ILE HG21 H N N 106 ILE HG22 H N N 107 ILE HG23 H N N 108 ILE HD11 H N N 109 ILE HD12 H N N 110 ILE HD13 H N N 111 ILE HXT H N N 112 LEU N N N N 113 LEU CA C N S 114 LEU C C N N 115 LEU O O N N 116 LEU CB C N N 117 LEU CG C N N 118 LEU CD1 C N N 119 LEU CD2 C N N 120 LEU OXT O N N 121 LEU H H N N 122 LEU H2 H N N 123 LEU HA H N N 124 LEU HB2 H N N 125 LEU HB3 H N N 126 LEU HG H N N 127 LEU HD11 H N N 128 LEU HD12 H N N 129 LEU HD13 H N N 130 LEU HD21 H N N 131 LEU HD22 H N N 132 LEU HD23 H N N 133 LEU HXT H N N 134 LYS N N N N 135 LYS CA C N S 136 LYS C C N N 137 LYS O O N N 138 LYS CB C N N 139 LYS CG C N N 140 LYS CD C N N 141 LYS CE C N N 142 LYS NZ N N N 143 LYS OXT O N N 144 LYS H H N N 145 LYS H2 H N N 146 LYS HA H N N 147 LYS HB2 H N N 148 LYS HB3 H N N 149 LYS HG2 H N N 150 LYS HG3 H N N 151 LYS HD2 H N N 152 LYS HD3 H N N 153 LYS HE2 H N N 154 LYS HE3 H N N 155 LYS HZ1 H N N 156 LYS HZ2 H N N 157 LYS HZ3 H N N 158 LYS HXT H N N 159 PHE N N N N 160 PHE CA C N S 161 PHE C C N N 162 PHE O O N N 163 PHE CB C N N 164 PHE CG C Y N 165 PHE CD1 C Y N 166 PHE CD2 C Y N 167 PHE CE1 C Y N 168 PHE CE2 C Y N 169 PHE CZ C Y N 170 PHE OXT O N N 171 PHE H H N N 172 PHE H2 H N N 173 PHE HA H N N 174 PHE HB2 H N N 175 PHE HB3 H N N 176 PHE HD1 H N N 177 PHE HD2 H N N 178 PHE HE1 H N N 179 PHE HE2 H N N 180 PHE HZ H N N 181 PHE HXT H N N 182 PRO N N N N 183 PRO CA C N S 184 PRO C C N N 185 PRO O O N N 186 PRO CB C N N 187 PRO CG C N N 188 PRO CD C N N 189 PRO OXT O N N 190 PRO H H N N 191 PRO HA H N N 192 PRO HB2 H N N 193 PRO HB3 H N N 194 PRO HG2 H N N 195 PRO HG3 H N N 196 PRO HD2 H N N 197 PRO HD3 H N N 198 PRO HXT H N N 199 SER N N N N 200 SER CA C N S 201 SER C C N N 202 SER O O N N 203 SER CB C N N 204 SER OG O N N 205 SER OXT O N N 206 SER H H N N 207 SER H2 H N N 208 SER HA H N N 209 SER HB2 H N N 210 SER HB3 H N N 211 SER HG H N N 212 SER HXT H N N 213 THR N N N N 214 THR CA C N S 215 THR C C N N 216 THR O O N N 217 THR CB C N R 218 THR OG1 O N N 219 THR CG2 C N N 220 THR OXT O N N 221 THR H H N N 222 THR H2 H N N 223 THR HA H N N 224 THR HB H N N 225 THR HG1 H N N 226 THR HG21 H N N 227 THR HG22 H N N 228 THR HG23 H N N 229 THR HXT H N N 230 TYR N N N N 231 TYR CA C N S 232 TYR C C N N 233 TYR O O N N 234 TYR CB C N N 235 TYR CG C Y N 236 TYR CD1 C Y N 237 TYR CD2 C Y N 238 TYR CE1 C Y N 239 TYR CE2 C Y N 240 TYR CZ C Y N 241 TYR OH O N N 242 TYR OXT O N N 243 TYR H H N N 244 TYR H2 H N N 245 TYR HA H N N 246 TYR HB2 H N N 247 TYR HB3 H N N 248 TYR HD1 H N N 249 TYR HD2 H N N 250 TYR HE1 H N N 251 TYR HE2 H N N 252 TYR HH H N N 253 TYR HXT H N N 254 VAL N N N N 255 VAL CA C N S 256 VAL C C N N 257 VAL O O N N 258 VAL CB C N N 259 VAL CG1 C N N 260 VAL CG2 C N N 261 VAL OXT O N N 262 VAL H H N N 263 VAL H2 H N N 264 VAL HA H N N 265 VAL HB H N N 266 VAL HG11 H N N 267 VAL HG12 H N N 268 VAL HG13 H N N 269 VAL HG21 H N N 270 VAL HG22 H N N 271 VAL HG23 H N N 272 VAL HXT H N N 273 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 GLU N CA sing N N 39 GLU N H sing N N 40 GLU N H2 sing N N 41 GLU CA C sing N N 42 GLU CA CB sing N N 43 GLU CA HA sing N N 44 GLU C O doub N N 45 GLU C OXT sing N N 46 GLU CB CG sing N N 47 GLU CB HB2 sing N N 48 GLU CB HB3 sing N N 49 GLU CG CD sing N N 50 GLU CG HG2 sing N N 51 GLU CG HG3 sing N N 52 GLU CD OE1 doub N N 53 GLU CD OE2 sing N N 54 GLU OE2 HE2 sing N N 55 GLU OXT HXT sing N N 56 GLY N CA sing N N 57 GLY N H sing N N 58 GLY N H2 sing N N 59 GLY CA C sing N N 60 GLY CA HA2 sing N N 61 GLY CA HA3 sing N N 62 GLY C O doub N N 63 GLY C OXT sing N N 64 GLY OXT HXT sing N N 65 HIS N CA sing N N 66 HIS N H sing N N 67 HIS N H2 sing N N 68 HIS CA C sing N N 69 HIS CA CB sing N N 70 HIS CA HA sing N N 71 HIS C O doub N N 72 HIS C OXT sing N N 73 HIS CB CG sing N N 74 HIS CB HB2 sing N N 75 HIS CB HB3 sing N N 76 HIS CG ND1 sing Y N 77 HIS CG CD2 doub Y N 78 HIS ND1 CE1 doub Y N 79 HIS ND1 HD1 sing N N 80 HIS CD2 NE2 sing Y N 81 HIS CD2 HD2 sing N N 82 HIS CE1 NE2 sing Y N 83 HIS CE1 HE1 sing N N 84 HIS NE2 HE2 sing N N 85 HIS OXT HXT sing N N 86 ILE N CA sing N N 87 ILE N H sing N N 88 ILE N H2 sing N N 89 ILE CA C sing N N 90 ILE CA CB sing N N 91 ILE CA HA sing N N 92 ILE C O doub N N 93 ILE C OXT sing N N 94 ILE CB CG1 sing N N 95 ILE CB CG2 sing N N 96 ILE CB HB sing N N 97 ILE CG1 CD1 sing N N 98 ILE CG1 HG12 sing N N 99 ILE CG1 HG13 sing N N 100 ILE CG2 HG21 sing N N 101 ILE CG2 HG22 sing N N 102 ILE CG2 HG23 sing N N 103 ILE CD1 HD11 sing N N 104 ILE CD1 HD12 sing N N 105 ILE CD1 HD13 sing N N 106 ILE OXT HXT sing N N 107 LEU N CA sing N N 108 LEU N H sing N N 109 LEU N H2 sing N N 110 LEU CA C sing N N 111 LEU CA CB sing N N 112 LEU CA HA sing N N 113 LEU C O doub N N 114 LEU C OXT sing N N 115 LEU CB CG sing N N 116 LEU CB HB2 sing N N 117 LEU CB HB3 sing N N 118 LEU CG CD1 sing N N 119 LEU CG CD2 sing N N 120 LEU CG HG sing N N 121 LEU CD1 HD11 sing N N 122 LEU CD1 HD12 sing N N 123 LEU CD1 HD13 sing N N 124 LEU CD2 HD21 sing N N 125 LEU CD2 HD22 sing N N 126 LEU CD2 HD23 sing N N 127 LEU OXT HXT sing N N 128 LYS N CA sing N N 129 LYS N H sing N N 130 LYS N H2 sing N N 131 LYS CA C sing N N 132 LYS CA CB sing N N 133 LYS CA HA sing N N 134 LYS C O doub N N 135 LYS C OXT sing N N 136 LYS CB CG sing N N 137 LYS CB HB2 sing N N 138 LYS CB HB3 sing N N 139 LYS CG CD sing N N 140 LYS CG HG2 sing N N 141 LYS CG HG3 sing N N 142 LYS CD CE sing N N 143 LYS CD HD2 sing N N 144 LYS CD HD3 sing N N 145 LYS CE NZ sing N N 146 LYS CE HE2 sing N N 147 LYS CE HE3 sing N N 148 LYS NZ HZ1 sing N N 149 LYS NZ HZ2 sing N N 150 LYS NZ HZ3 sing N N 151 LYS OXT HXT sing N N 152 PHE N CA sing N N 153 PHE N H sing N N 154 PHE N H2 sing N N 155 PHE CA C sing N N 156 PHE CA CB sing N N 157 PHE CA HA sing N N 158 PHE C O doub N N 159 PHE C OXT sing N N 160 PHE CB CG sing N N 161 PHE CB HB2 sing N N 162 PHE CB HB3 sing N N 163 PHE CG CD1 doub Y N 164 PHE CG CD2 sing Y N 165 PHE CD1 CE1 sing Y N 166 PHE CD1 HD1 sing N N 167 PHE CD2 CE2 doub Y N 168 PHE CD2 HD2 sing N N 169 PHE CE1 CZ doub Y N 170 PHE CE1 HE1 sing N N 171 PHE CE2 CZ sing Y N 172 PHE CE2 HE2 sing N N 173 PHE CZ HZ sing N N 174 PHE OXT HXT sing N N 175 PRO N CA sing N N 176 PRO N CD sing N N 177 PRO N H sing N N 178 PRO CA C sing N N 179 PRO CA CB sing N N 180 PRO CA HA sing N N 181 PRO C O doub N N 182 PRO C OXT sing N N 183 PRO CB CG sing N N 184 PRO CB HB2 sing N N 185 PRO CB HB3 sing N N 186 PRO CG CD sing N N 187 PRO CG HG2 sing N N 188 PRO CG HG3 sing N N 189 PRO CD HD2 sing N N 190 PRO CD HD3 sing N N 191 PRO OXT HXT sing N N 192 SER N CA sing N N 193 SER N H sing N N 194 SER N H2 sing N N 195 SER CA C sing N N 196 SER CA CB sing N N 197 SER CA HA sing N N 198 SER C O doub N N 199 SER C OXT sing N N 200 SER CB OG sing N N 201 SER CB HB2 sing N N 202 SER CB HB3 sing N N 203 SER OG HG sing N N 204 SER OXT HXT sing N N 205 THR N CA sing N N 206 THR N H sing N N 207 THR N H2 sing N N 208 THR CA C sing N N 209 THR CA CB sing N N 210 THR CA HA sing N N 211 THR C O doub N N 212 THR C OXT sing N N 213 THR CB OG1 sing N N 214 THR CB CG2 sing N N 215 THR CB HB sing N N 216 THR OG1 HG1 sing N N 217 THR CG2 HG21 sing N N 218 THR CG2 HG22 sing N N 219 THR CG2 HG23 sing N N 220 THR OXT HXT sing N N 221 TYR N CA sing N N 222 TYR N H sing N N 223 TYR N H2 sing N N 224 TYR CA C sing N N 225 TYR CA CB sing N N 226 TYR CA HA sing N N 227 TYR C O doub N N 228 TYR C OXT sing N N 229 TYR CB CG sing N N 230 TYR CB HB2 sing N N 231 TYR CB HB3 sing N N 232 TYR CG CD1 doub Y N 233 TYR CG CD2 sing Y N 234 TYR CD1 CE1 sing Y N 235 TYR CD1 HD1 sing N N 236 TYR CD2 CE2 doub Y N 237 TYR CD2 HD2 sing N N 238 TYR CE1 CZ doub Y N 239 TYR CE1 HE1 sing N N 240 TYR CE2 CZ sing Y N 241 TYR CE2 HE2 sing N N 242 TYR CZ OH sing N N 243 TYR OH HH sing N N 244 TYR OXT HXT sing N N 245 VAL N CA sing N N 246 VAL N H sing N N 247 VAL N H2 sing N N 248 VAL CA C sing N N 249 VAL CA CB sing N N 250 VAL CA HA sing N N 251 VAL C O doub N N 252 VAL C OXT sing N N 253 VAL CB CG1 sing N N 254 VAL CB CG2 sing N N 255 VAL CB HB sing N N 256 VAL CG1 HG11 sing N N 257 VAL CG1 HG12 sing N N 258 VAL CG1 HG13 sing N N 259 VAL CG2 HG21 sing N N 260 VAL CG2 HG22 sing N N 261 VAL CG2 HG23 sing N N 262 VAL OXT HXT sing N N 263 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Varian INOVA 1 'Varian INOVA' 600 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2KA1 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_