data_2KAP # _entry.id 2KAP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KAP pdb_00002kap 10.2210/pdb2kap/pdb RCSB RCSB100887 ? ? WWPDB D_1000100887 ? ? # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KAP _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-11-12 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yang, S.' 1 'Yang, D.' 2 # _citation.id primary _citation.title 'Characterization of DLC1-SAM equilibrium unfolding at the amino acid residue level' _citation.journal_abbrev Biochemistry _citation.journal_volume 48 _citation.page_first 4040 _citation.page_last 4049 _citation.year 2009 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19317456 _citation.pdbx_database_id_DOI 10.1021/bi9000936 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yang, S.' 1 ? primary 'Noble, C.G.' 2 ? primary 'Yang, D.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Rho GTPase-activating protein 7' _entity.formula_weight 7102.202 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'sterile alpha motif (SAM) domain, UNP residues 17-76' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Rho-type GTPase-activating protein 7, Deleted in liver cancer 1 protein, Dlc-1, StAR-related lipid transfer protein 12, START domain-containing protein 12, StARD12, HP protein ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KEACDWLRATGFPQYAQLYEDFLFPIDISLVKREHDFLDRDAIEALCRRLNTLNKCAVMK _entity_poly.pdbx_seq_one_letter_code_can KEACDWLRATGFPQYAQLYEDFLFPIDISLVKREHDFLDRDAIEALCRRLNTLNKCAVMK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 GLU n 1 3 ALA n 1 4 CYS n 1 5 ASP n 1 6 TRP n 1 7 LEU n 1 8 ARG n 1 9 ALA n 1 10 THR n 1 11 GLY n 1 12 PHE n 1 13 PRO n 1 14 GLN n 1 15 TYR n 1 16 ALA n 1 17 GLN n 1 18 LEU n 1 19 TYR n 1 20 GLU n 1 21 ASP n 1 22 PHE n 1 23 LEU n 1 24 PHE n 1 25 PRO n 1 26 ILE n 1 27 ASP n 1 28 ILE n 1 29 SER n 1 30 LEU n 1 31 VAL n 1 32 LYS n 1 33 ARG n 1 34 GLU n 1 35 HIS n 1 36 ASP n 1 37 PHE n 1 38 LEU n 1 39 ASP n 1 40 ARG n 1 41 ASP n 1 42 ALA n 1 43 ILE n 1 44 GLU n 1 45 ALA n 1 46 LEU n 1 47 CYS n 1 48 ARG n 1 49 ARG n 1 50 LEU n 1 51 ASN n 1 52 THR n 1 53 LEU n 1 54 ASN n 1 55 LYS n 1 56 CYS n 1 57 ALA n 1 58 VAL n 1 59 MET n 1 60 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene DLC1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET32A-derived _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RHG07_HUMAN _struct_ref.pdbx_db_accession Q96QB1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KEACDWLRATGFPQYAQLYEDFLFPIDISLVKREHDFLDRDAIEALCRRLNTLNKCAVMK _struct_ref.pdbx_align_begin 17 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KAP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 60 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96QB1 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 76 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 60 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '1D 1H SPECTRUM' 1 2 2 '2D 1H-15N HSQC' 1 3 3 '2D 1H-13C HSQC' 1 4 4 '2D DQF-COSY' 1 5 4 '2D 1H-1H NOESY' 1 6 4 '2D 1H-1H TOCSY' 1 7 3 '3D CBCA(CO)NH' 1 8 3 '3D HNCACB' 1 9 3 '3D HCCH-TOCSY' 1 10 2 '3D 1H-15N NOESY' 1 11 2 '3D 1H-15N TOCSY' 1 12 5 '3D 1H-13C NOESY' 1 13 3 '3D H(CCO)NH' 1 14 3 '3D CC(CO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1mM DLC1-SAM, 50mM sodium phosphate, 3mM DTT, 5% [U-100% 2H] D2O, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '1mM [U-100% 15N] DLC1-SAM, 50mM sodium phosphate, 3mM DTT, 5% [U-100% 2H] D2O, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' '1mM [U-100% 13C; U-100% 15N] DLC1-SAM, 50mM sodium phosphate, 3mM DTT, 5% [U-100% 2H] D2O, 95% H2O/5% D2O' 3 '95% H2O/5% D2O' '1mM DLC1-SAM, 50mM sodium phosphate, 3mM DTT, 100 % D2O, 100% D2O' 4 '100% D2O' '1mM [U-100% 13C; U-100% 15N] DLC1-SAM, 50mM sodium phosphate, 3mM DTT, 100% D2O, 100% D2O' 5 '100% D2O' # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KAP _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KAP _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KAP _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' 'geometry optimization' Amber ? 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 2 'Koradi, Billeter and Wuthrich' 'graphic display' MOLMOL ? 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRDraw ? 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 5 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 6 'Johnson, One Moon Scientific' 'chemical shift calculation' NMRView ? 7 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 8 'Johnson, One Moon Scientific' 'peak picking' NMRView ? 9 'Laskowski and MacArthur' 'structure validation' ProcheckNMR ? 10 'Cornilescu, Delaglio and Bax' refinement TALOS ? 11 'Bruker Biospin' collection XwinNMR ? 12 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KAP _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KAP _struct.title 'Solution structure of DLC1-SAM' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KAP _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'Solution Structure, SAM domain, DLC-1, Cytoplasm, GTPase activation, Phosphoprotein, Polymorphism, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 1 ? GLY A 11 ? LYS A 1 GLY A 11 1 ? 11 HELX_P HELX_P2 2 PHE A 12 ? ASP A 21 ? PHE A 12 ASP A 21 1 ? 10 HELX_P HELX_P3 3 ASP A 27 ? HIS A 35 ? ASP A 27 HIS A 35 1 ? 9 HELX_P HELX_P4 4 ASP A 39 ? VAL A 58 ? ASP A 39 VAL A 58 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2KAP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 LYS 60 60 60 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-10-20 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id DLC1-SAM 1 mM ? 1 'sodium phosphate' 50 mM ? 1 DTT 3 mM ? 1 D2O 5 % '[U-100% 2H]' 1 DLC1-SAM 1 mM '[U-100% 15N]' 2 'sodium phosphate' 50 mM ? 2 DTT 3 mM ? 2 D2O 5 % '[U-100% 2H]' 2 DLC1-SAM 1 mM '[U-100% 13C; U-100% 15N]' 3 'sodium phosphate' 50 mM ? 3 DTT 3 mM ? 3 D2O 5 % '[U-100% 2H]' 3 DLC1-SAM 1 mM ? 4 'sodium phosphate' 50 mM ? 4 DTT 3 mM ? 4 D2O 100 % ? 4 DLC1-SAM 1 mM '[U-100% 13C; U-100% 15N]' 5 'sodium phosphate' 50 mM ? 5 DTT 3 mM ? 5 D2O 100 % ? 5 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 NE A ARG 48 ? ? CZ A ARG 48 ? ? NH1 A ARG 48 ? ? 123.47 120.30 3.17 0.50 N 2 6 CB A TYR 15 ? ? CG A TYR 15 ? ? CD2 A TYR 15 ? ? 117.38 121.00 -3.62 0.60 N 3 8 CB A TYR 15 ? ? CG A TYR 15 ? ? CD2 A TYR 15 ? ? 116.78 121.00 -4.22 0.60 N 4 10 CB A ASP 21 ? ? CG A ASP 21 ? ? OD1 A ASP 21 ? ? 124.20 118.30 5.90 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 12 ? ? -115.08 62.65 2 1 ASP A 21 ? ? -92.75 34.45 3 1 PHE A 22 ? ? -59.00 4.60 4 1 MET A 59 ? ? -67.33 62.78 5 2 PHE A 12 ? ? -112.57 67.67 6 2 ASP A 21 ? ? -92.80 34.93 7 2 PHE A 22 ? ? -56.27 0.06 8 3 PHE A 12 ? ? -114.18 63.50 9 3 ASP A 21 ? ? -96.72 35.81 10 3 PHE A 22 ? ? -52.36 -3.40 11 4 PHE A 12 ? ? -114.07 62.10 12 4 ASP A 21 ? ? -93.14 37.45 13 4 PHE A 22 ? ? -56.78 1.99 14 4 ASP A 36 ? ? -78.35 31.89 15 4 MET A 59 ? ? -73.49 44.95 16 5 PHE A 12 ? ? -114.64 66.99 17 5 ASP A 21 ? ? -85.43 46.19 18 5 PHE A 22 ? ? -57.12 -8.30 19 6 PHE A 12 ? ? -112.20 64.95 20 6 ASP A 21 ? ? -84.65 37.10 21 6 PHE A 22 ? ? -57.28 -6.95 22 6 MET A 59 ? ? -63.29 82.19 23 7 PHE A 12 ? ? -114.77 66.41 24 7 ASP A 21 ? ? -92.74 37.12 25 7 PHE A 22 ? ? -55.74 -0.96 26 7 MET A 59 ? ? -59.88 99.00 27 8 PHE A 12 ? ? -114.34 62.21 28 8 ASP A 21 ? ? -91.15 35.64 29 8 PHE A 22 ? ? -54.79 -3.61 30 9 PHE A 12 ? ? -114.71 68.78 31 9 PHE A 22 ? ? -51.52 -6.30 32 9 HIS A 35 ? ? -119.75 66.06 33 10 PHE A 12 ? ? -117.71 62.50 34 10 PHE A 22 ? ? -53.09 -5.27 #