data_2KB7 # _entry.id 2KB7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KB7 pdb_00002kb7 10.2210/pdb2kb7/pdb RCSB RCSB100904 ? ? WWPDB D_1000100904 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-06-16 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KB7 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-11-21 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 1N7L _pdbx_database_related.db_name PDB _pdbx_database_related.details 'Solution NMR structure of monomeric phospholamban' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Traaseth, N.J.' 1 'Shi, L.' 2 'Verardi, R.' 3 'Veglia, G.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure and topology of monomeric phospholamban in lipid membranes determined by a hybrid solution and solid-state NMR approach.' Proc.Natl.Acad.Sci.USA 106 10165 10170 2009 PNASA6 US 0027-8424 0040 ? 19509339 10.1073/pnas.0904290106 1 ;A refinement protocol to determine structure, topology, and depth of insertion of membrane proteins using hybrid solution and solid-state NMR restraints. ; J.Biomol.Nmr 44 195 205 2009 JBNME9 NE 0925-2738 0800 ? 19597943 10.1007/s10858-009-9328-9 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Traaseth, N.J.' 1 ? primary 'Shi, L.' 2 ? primary 'Verardi, R.' 3 ? primary 'Mullen, D.G.' 4 ? primary 'Barany, G.' 5 ? primary 'Veglia, G.' 6 ? 1 'Shi, L.' 7 ? 1 'Traaseth, N.J.' 8 ? 1 'Verardi, R.' 9 ? 1 'Cembran, A.' 10 ? 1 'Gao, J.' 11 ? 1 'Veglia, G.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Phospholamban _entity.formula_weight 6150.477 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AMEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFALILIFLLLIAIIVMLL _entity_poly.pdbx_seq_one_letter_code_can AMEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFALILIFLLLIAIIVMLL _entity_poly.pdbx_strand_id P _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 MET n 1 3 GLU n 1 4 LYS n 1 5 VAL n 1 6 GLN n 1 7 TYR n 1 8 LEU n 1 9 THR n 1 10 ARG n 1 11 SER n 1 12 ALA n 1 13 ILE n 1 14 ARG n 1 15 ARG n 1 16 ALA n 1 17 SER n 1 18 THR n 1 19 ILE n 1 20 GLU n 1 21 MET n 1 22 PRO n 1 23 GLN n 1 24 GLN n 1 25 ALA n 1 26 ARG n 1 27 GLN n 1 28 ASN n 1 29 LEU n 1 30 GLN n 1 31 ASN n 1 32 LEU n 1 33 PHE n 1 34 ILE n 1 35 ASN n 1 36 PHE n 1 37 ALA n 1 38 LEU n 1 39 ILE n 1 40 LEU n 1 41 ILE n 1 42 PHE n 1 43 LEU n 1 44 LEU n 1 45 LEU n 1 46 ILE n 1 47 ALA n 1 48 ILE n 1 49 ILE n 1 50 VAL n 1 51 MET n 1 52 LEU n 1 53 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene pln _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Bl21de3phi _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMAL _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA P . n A 1 2 MET 2 2 2 MET MET P . n A 1 3 GLU 3 3 3 GLU GLU P . n A 1 4 LYS 4 4 4 LYS LYS P . n A 1 5 VAL 5 5 5 VAL VAL P . n A 1 6 GLN 6 6 6 GLN GLN P . n A 1 7 TYR 7 7 7 TYR TYR P . n A 1 8 LEU 8 8 8 LEU LEU P . n A 1 9 THR 9 9 9 THR THR P . n A 1 10 ARG 10 10 10 ARG ARG P . n A 1 11 SER 11 11 11 SER SER P . n A 1 12 ALA 12 12 12 ALA ALA P . n A 1 13 ILE 13 13 13 ILE ILE P . n A 1 14 ARG 14 14 14 ARG ARG P . n A 1 15 ARG 15 15 15 ARG ARG P . n A 1 16 ALA 16 16 16 ALA ALA P . n A 1 17 SER 17 17 17 SER SER P . n A 1 18 THR 18 18 18 THR THR P . n A 1 19 ILE 19 19 19 ILE ILE P . n A 1 20 GLU 20 20 20 GLU GLU P . n A 1 21 MET 21 21 21 MET MET P . n A 1 22 PRO 22 22 22 PRO PRO P . n A 1 23 GLN 23 23 23 GLN GLN P . n A 1 24 GLN 24 24 24 GLN GLN P . n A 1 25 ALA 25 25 25 ALA ALA P . n A 1 26 ARG 26 26 26 ARG ARG P . n A 1 27 GLN 27 27 27 GLN GLN P . n A 1 28 ASN 28 28 28 ASN ASN P . n A 1 29 LEU 29 29 29 LEU LEU P . n A 1 30 GLN 30 30 30 GLN GLN P . n A 1 31 ASN 31 31 31 ASN ASN P . n A 1 32 LEU 32 32 32 LEU LEU P . n A 1 33 PHE 33 33 33 PHE PHE P . n A 1 34 ILE 34 34 34 ILE ILE P . n A 1 35 ASN 35 35 35 ASN ASN P . n A 1 36 PHE 36 36 36 PHE PHE P . n A 1 37 ALA 37 37 37 ALA ALA P . n A 1 38 LEU 38 38 38 LEU LEU P . n A 1 39 ILE 39 39 39 ILE ILE P . n A 1 40 LEU 40 40 40 LEU LEU P . n A 1 41 ILE 41 41 41 ILE ILE P . n A 1 42 PHE 42 42 42 PHE PHE P . n A 1 43 LEU 43 43 43 LEU LEU P . n A 1 44 LEU 44 44 44 LEU LEU P . n A 1 45 LEU 45 45 45 LEU LEU P . n A 1 46 ILE 46 46 46 ILE ILE P . n A 1 47 ALA 47 47 47 ALA ALA P . n A 1 48 ILE 48 48 48 ILE ILE P . n A 1 49 ILE 49 49 49 ILE ILE P . n A 1 50 VAL 50 50 50 VAL VAL P . n A 1 51 MET 51 51 51 MET MET P . n A 1 52 LEU 52 52 52 LEU LEU P . n A 1 53 LEU 53 53 53 LEU LEU P . n # loop_ _exptl.absorpt_coefficient_mu _exptl.absorpt_correction_T_max _exptl.absorpt_correction_T_min _exptl.absorpt_correction_type _exptl.absorpt_process_details _exptl.crystals_number _exptl.details _exptl.entry_id _exptl.method _exptl.method_details ? ? ? ? ? ? ? 2KB7 'SOLUTION NMR' ? ? ? ? ? ? ? ? 2KB7 'SOLID-STATE NMR' ? # _struct.entry_id 2KB7 _struct.title 'Hybrid solution and solid-state NMR structure of monomeric phospholamban in lipid bilayers' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag Y _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KB7 _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'phospholamban, PISEMA, hybrid method, lipid bilayers, topology, MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2KB7 _struct_ref.pdbx_db_accession 2KB7 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KB7 _struct_ref_seq.pdbx_strand_id P _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 53 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2KB7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 53 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 53 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 4 ? ILE A 19 ? LYS P 4 ILE P 19 1 ? 16 HELX_P HELX_P2 2 GLN A 24 ? LEU A 53 ? GLN P 24 LEU P 53 1 ? 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O P LEU 32 ? ? H P PHE 36 ? ? 1.59 2 2 O P ALA 37 ? ? H P ILE 41 ? ? 1.55 3 3 O P SER 11 ? ? H P ARG 15 ? ? 1.57 4 3 O P ALA 37 ? ? H P ILE 41 ? ? 1.60 5 6 O P LEU 32 ? ? H P PHE 36 ? ? 1.56 6 6 O P ARG 14 ? ? H P SER 17 ? ? 1.58 7 7 O P LEU 32 ? ? H P PHE 36 ? ? 1.60 8 11 HD22 P ASN 31 ? ? HD22 P ASN 35 ? ? 1.31 9 14 H3 P ALA 1 ? ? H P MET 2 ? ? 1.32 10 15 O P ALA 37 ? ? H P ILE 41 ? ? 1.60 11 16 O P SER 11 ? ? H P ARG 15 ? ? 1.58 12 18 O P LEU 32 ? ? H P PHE 36 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS P 4 ? ? 55.44 -3.68 2 1 ILE P 19 ? ? -34.78 -28.21 3 2 PRO P 22 ? ? -30.07 129.75 4 3 PRO P 22 ? ? -27.35 131.63 5 3 ARG P 26 ? ? -62.84 -74.68 6 4 MET P 21 ? ? -90.75 -71.11 7 4 PRO P 22 ? ? -66.71 -87.46 8 4 GLN P 23 ? ? -155.67 -79.24 9 4 GLN P 24 ? ? -62.96 0.27 10 5 MET P 21 ? ? -99.42 -69.53 11 5 PRO P 22 ? ? -64.39 -85.50 12 5 GLN P 23 ? ? -155.43 -82.11 13 5 GLN P 24 ? ? -69.22 8.87 14 6 ARG P 15 ? ? -41.18 -19.00 15 6 SER P 17 ? ? -76.15 -81.55 16 6 GLU P 20 ? ? -177.83 -124.59 17 6 MET P 21 ? ? -160.49 -53.87 18 6 PRO P 22 ? ? -97.07 -76.43 19 6 GLN P 23 ? ? -127.39 -133.29 20 7 LYS P 4 ? ? 53.56 -0.99 21 7 ILE P 19 ? ? -35.40 -27.63 22 8 MET P 2 ? ? -87.46 -94.34 23 8 ILE P 19 ? ? -34.76 -28.30 24 9 ILE P 19 ? ? -37.43 -30.33 25 9 PRO P 22 ? ? -37.70 124.73 26 10 ILE P 19 ? ? -43.14 -19.16 27 10 GLU P 20 ? ? -133.09 -65.26 28 10 MET P 21 ? ? -175.75 113.09 29 11 ILE P 19 ? ? -36.05 -28.83 30 11 PRO P 22 ? ? -98.27 -98.49 31 11 GLN P 23 ? ? -158.46 -17.63 32 12 MET P 2 ? ? -32.84 -34.83 33 12 ILE P 19 ? ? -37.09 -23.84 34 12 GLU P 20 ? ? -146.59 -57.50 35 12 MET P 21 ? ? 178.98 117.77 36 13 SER P 17 ? ? -72.52 -77.65 37 13 ILE P 19 ? ? 3.81 115.40 38 13 GLU P 20 ? ? 4.89 94.64 39 13 GLN P 23 ? ? -163.68 -34.38 40 14 PRO P 22 ? ? -36.97 124.11 41 14 ARG P 26 ? ? -65.42 -76.90 42 15 ILE P 19 ? ? -35.95 -29.53 43 15 PRO P 22 ? ? -39.89 125.25 44 16 ARG P 26 ? ? -64.94 -75.00 45 17 ILE P 19 ? ? 4.24 112.41 46 17 GLU P 20 ? ? -20.51 82.07 47 17 GLN P 23 ? ? -159.87 -43.56 48 18 ILE P 19 ? ? 2.37 114.58 49 18 GLU P 20 ? ? -1.02 92.13 50 18 PRO P 22 ? ? -44.75 -70.98 51 18 GLN P 23 ? ? -166.32 -25.42 52 19 ILE P 19 ? ? -38.91 -26.83 53 19 PRO P 22 ? ? -38.58 122.81 54 20 ILE P 19 ? ? 3.18 110.93 55 20 GLU P 20 ? ? 2.57 -100.13 56 20 MET P 21 ? ? 2.08 75.01 57 20 GLN P 23 ? ? -156.73 -26.31 58 20 GLN P 24 ? ? -104.61 -71.97 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KB7 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KB7 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.5 mM [U-99% 15N] and [U-99% 13C; U-99% 15N] Phospholamban, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' ;160/1 lipid/protein (mol/mol) [U-99% 15N] and [15N-Ala] and [15N-Arg] and [15N-Asn] and [15N-Ile] and [15N-Met] and [15N-Leu] and [15N-Phe] and [15N-Val] and [15N-Ser] and [15N-Gln26,Gln29] Phospholamban, 100% H2O ; 2 '100% H2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Phospholamban 1.5 mM '[U-99% 15N] and [U-99% 13C; U-99% 15N]' 1 Phospholamban ? % ;[U-99% 15N] and [15N-Ala] and [15N-Arg] and [15N-Asn] and [15N-Ile] and [15N-Met] and [15N-Leu] and [15N-Phe] and [15N-Val] and [15N-Ser] and [15N-Gln26,Gln29] ; 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D H(CCO)NH' 1 3 1 '3D C(CO)NH' 1 4 1 '3D 1H-15N NOESY' 2 5 2 '2D [1H,15N] PISEMA' 2 6 2 '2D [1H,15N]SAMPI4' # _pdbx_nmr_refine.entry_id 2KB7 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;Authors state that they define the z-axis to be parallel with the bilayer normal. Also, the origin (or in other words, when the z Cartesian coordinate is 0) is defined to be the center of the lipid bilayer. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, C. et al.' refinement 'X-PLOR NIH' 2.18 1 'Schwieters, C. et al.' 'data analysis' 'X-PLOR NIH' 2.18 2 'Schwieters, C. et al.' 'structure solution' 'X-PLOR NIH' 2.18 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 ILE N N N N 97 ILE CA C N S 98 ILE C C N N 99 ILE O O N N 100 ILE CB C N S 101 ILE CG1 C N N 102 ILE CG2 C N N 103 ILE CD1 C N N 104 ILE OXT O N N 105 ILE H H N N 106 ILE H2 H N N 107 ILE HA H N N 108 ILE HB H N N 109 ILE HG12 H N N 110 ILE HG13 H N N 111 ILE HG21 H N N 112 ILE HG22 H N N 113 ILE HG23 H N N 114 ILE HD11 H N N 115 ILE HD12 H N N 116 ILE HD13 H N N 117 ILE HXT H N N 118 LEU N N N N 119 LEU CA C N S 120 LEU C C N N 121 LEU O O N N 122 LEU CB C N N 123 LEU CG C N N 124 LEU CD1 C N N 125 LEU CD2 C N N 126 LEU OXT O N N 127 LEU H H N N 128 LEU H2 H N N 129 LEU HA H N N 130 LEU HB2 H N N 131 LEU HB3 H N N 132 LEU HG H N N 133 LEU HD11 H N N 134 LEU HD12 H N N 135 LEU HD13 H N N 136 LEU HD21 H N N 137 LEU HD22 H N N 138 LEU HD23 H N N 139 LEU HXT H N N 140 LYS N N N N 141 LYS CA C N S 142 LYS C C N N 143 LYS O O N N 144 LYS CB C N N 145 LYS CG C N N 146 LYS CD C N N 147 LYS CE C N N 148 LYS NZ N N N 149 LYS OXT O N N 150 LYS H H N N 151 LYS H2 H N N 152 LYS HA H N N 153 LYS HB2 H N N 154 LYS HB3 H N N 155 LYS HG2 H N N 156 LYS HG3 H N N 157 LYS HD2 H N N 158 LYS HD3 H N N 159 LYS HE2 H N N 160 LYS HE3 H N N 161 LYS HZ1 H N N 162 LYS HZ2 H N N 163 LYS HZ3 H N N 164 LYS HXT H N N 165 MET N N N N 166 MET CA C N S 167 MET C C N N 168 MET O O N N 169 MET CB C N N 170 MET CG C N N 171 MET SD S N N 172 MET CE C N N 173 MET OXT O N N 174 MET H H N N 175 MET H2 H N N 176 MET HA H N N 177 MET HB2 H N N 178 MET HB3 H N N 179 MET HG2 H N N 180 MET HG3 H N N 181 MET HE1 H N N 182 MET HE2 H N N 183 MET HE3 H N N 184 MET HXT H N N 185 PHE N N N N 186 PHE CA C N S 187 PHE C C N N 188 PHE O O N N 189 PHE CB C N N 190 PHE CG C Y N 191 PHE CD1 C Y N 192 PHE CD2 C Y N 193 PHE CE1 C Y N 194 PHE CE2 C Y N 195 PHE CZ C Y N 196 PHE OXT O N N 197 PHE H H N N 198 PHE H2 H N N 199 PHE HA H N N 200 PHE HB2 H N N 201 PHE HB3 H N N 202 PHE HD1 H N N 203 PHE HD2 H N N 204 PHE HE1 H N N 205 PHE HE2 H N N 206 PHE HZ H N N 207 PHE HXT H N N 208 PRO N N N N 209 PRO CA C N S 210 PRO C C N N 211 PRO O O N N 212 PRO CB C N N 213 PRO CG C N N 214 PRO CD C N N 215 PRO OXT O N N 216 PRO H H N N 217 PRO HA H N N 218 PRO HB2 H N N 219 PRO HB3 H N N 220 PRO HG2 H N N 221 PRO HG3 H N N 222 PRO HD2 H N N 223 PRO HD3 H N N 224 PRO HXT H N N 225 SER N N N N 226 SER CA C N S 227 SER C C N N 228 SER O O N N 229 SER CB C N N 230 SER OG O N N 231 SER OXT O N N 232 SER H H N N 233 SER H2 H N N 234 SER HA H N N 235 SER HB2 H N N 236 SER HB3 H N N 237 SER HG H N N 238 SER HXT H N N 239 THR N N N N 240 THR CA C N S 241 THR C C N N 242 THR O O N N 243 THR CB C N R 244 THR OG1 O N N 245 THR CG2 C N N 246 THR OXT O N N 247 THR H H N N 248 THR H2 H N N 249 THR HA H N N 250 THR HB H N N 251 THR HG1 H N N 252 THR HG21 H N N 253 THR HG22 H N N 254 THR HG23 H N N 255 THR HXT H N N 256 TYR N N N N 257 TYR CA C N S 258 TYR C C N N 259 TYR O O N N 260 TYR CB C N N 261 TYR CG C Y N 262 TYR CD1 C Y N 263 TYR CD2 C Y N 264 TYR CE1 C Y N 265 TYR CE2 C Y N 266 TYR CZ C Y N 267 TYR OH O N N 268 TYR OXT O N N 269 TYR H H N N 270 TYR H2 H N N 271 TYR HA H N N 272 TYR HB2 H N N 273 TYR HB3 H N N 274 TYR HD1 H N N 275 TYR HD2 H N N 276 TYR HE1 H N N 277 TYR HE2 H N N 278 TYR HH H N N 279 TYR HXT H N N 280 VAL N N N N 281 VAL CA C N S 282 VAL C C N N 283 VAL O O N N 284 VAL CB C N N 285 VAL CG1 C N N 286 VAL CG2 C N N 287 VAL OXT O N N 288 VAL H H N N 289 VAL H2 H N N 290 VAL HA H N N 291 VAL HB H N N 292 VAL HG11 H N N 293 VAL HG12 H N N 294 VAL HG13 H N N 295 VAL HG21 H N N 296 VAL HG22 H N N 297 VAL HG23 H N N 298 VAL HXT H N N 299 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 ILE N CA sing N N 92 ILE N H sing N N 93 ILE N H2 sing N N 94 ILE CA C sing N N 95 ILE CA CB sing N N 96 ILE CA HA sing N N 97 ILE C O doub N N 98 ILE C OXT sing N N 99 ILE CB CG1 sing N N 100 ILE CB CG2 sing N N 101 ILE CB HB sing N N 102 ILE CG1 CD1 sing N N 103 ILE CG1 HG12 sing N N 104 ILE CG1 HG13 sing N N 105 ILE CG2 HG21 sing N N 106 ILE CG2 HG22 sing N N 107 ILE CG2 HG23 sing N N 108 ILE CD1 HD11 sing N N 109 ILE CD1 HD12 sing N N 110 ILE CD1 HD13 sing N N 111 ILE OXT HXT sing N N 112 LEU N CA sing N N 113 LEU N H sing N N 114 LEU N H2 sing N N 115 LEU CA C sing N N 116 LEU CA CB sing N N 117 LEU CA HA sing N N 118 LEU C O doub N N 119 LEU C OXT sing N N 120 LEU CB CG sing N N 121 LEU CB HB2 sing N N 122 LEU CB HB3 sing N N 123 LEU CG CD1 sing N N 124 LEU CG CD2 sing N N 125 LEU CG HG sing N N 126 LEU CD1 HD11 sing N N 127 LEU CD1 HD12 sing N N 128 LEU CD1 HD13 sing N N 129 LEU CD2 HD21 sing N N 130 LEU CD2 HD22 sing N N 131 LEU CD2 HD23 sing N N 132 LEU OXT HXT sing N N 133 LYS N CA sing N N 134 LYS N H sing N N 135 LYS N H2 sing N N 136 LYS CA C sing N N 137 LYS CA CB sing N N 138 LYS CA HA sing N N 139 LYS C O doub N N 140 LYS C OXT sing N N 141 LYS CB CG sing N N 142 LYS CB HB2 sing N N 143 LYS CB HB3 sing N N 144 LYS CG CD sing N N 145 LYS CG HG2 sing N N 146 LYS CG HG3 sing N N 147 LYS CD CE sing N N 148 LYS CD HD2 sing N N 149 LYS CD HD3 sing N N 150 LYS CE NZ sing N N 151 LYS CE HE2 sing N N 152 LYS CE HE3 sing N N 153 LYS NZ HZ1 sing N N 154 LYS NZ HZ2 sing N N 155 LYS NZ HZ3 sing N N 156 LYS OXT HXT sing N N 157 MET N CA sing N N 158 MET N H sing N N 159 MET N H2 sing N N 160 MET CA C sing N N 161 MET CA CB sing N N 162 MET CA HA sing N N 163 MET C O doub N N 164 MET C OXT sing N N 165 MET CB CG sing N N 166 MET CB HB2 sing N N 167 MET CB HB3 sing N N 168 MET CG SD sing N N 169 MET CG HG2 sing N N 170 MET CG HG3 sing N N 171 MET SD CE sing N N 172 MET CE HE1 sing N N 173 MET CE HE2 sing N N 174 MET CE HE3 sing N N 175 MET OXT HXT sing N N 176 PHE N CA sing N N 177 PHE N H sing N N 178 PHE N H2 sing N N 179 PHE CA C sing N N 180 PHE CA CB sing N N 181 PHE CA HA sing N N 182 PHE C O doub N N 183 PHE C OXT sing N N 184 PHE CB CG sing N N 185 PHE CB HB2 sing N N 186 PHE CB HB3 sing N N 187 PHE CG CD1 doub Y N 188 PHE CG CD2 sing Y N 189 PHE CD1 CE1 sing Y N 190 PHE CD1 HD1 sing N N 191 PHE CD2 CE2 doub Y N 192 PHE CD2 HD2 sing N N 193 PHE CE1 CZ doub Y N 194 PHE CE1 HE1 sing N N 195 PHE CE2 CZ sing Y N 196 PHE CE2 HE2 sing N N 197 PHE CZ HZ sing N N 198 PHE OXT HXT sing N N 199 PRO N CA sing N N 200 PRO N CD sing N N 201 PRO N H sing N N 202 PRO CA C sing N N 203 PRO CA CB sing N N 204 PRO CA HA sing N N 205 PRO C O doub N N 206 PRO C OXT sing N N 207 PRO CB CG sing N N 208 PRO CB HB2 sing N N 209 PRO CB HB3 sing N N 210 PRO CG CD sing N N 211 PRO CG HG2 sing N N 212 PRO CG HG3 sing N N 213 PRO CD HD2 sing N N 214 PRO CD HD3 sing N N 215 PRO OXT HXT sing N N 216 SER N CA sing N N 217 SER N H sing N N 218 SER N H2 sing N N 219 SER CA C sing N N 220 SER CA CB sing N N 221 SER CA HA sing N N 222 SER C O doub N N 223 SER C OXT sing N N 224 SER CB OG sing N N 225 SER CB HB2 sing N N 226 SER CB HB3 sing N N 227 SER OG HG sing N N 228 SER OXT HXT sing N N 229 THR N CA sing N N 230 THR N H sing N N 231 THR N H2 sing N N 232 THR CA C sing N N 233 THR CA CB sing N N 234 THR CA HA sing N N 235 THR C O doub N N 236 THR C OXT sing N N 237 THR CB OG1 sing N N 238 THR CB CG2 sing N N 239 THR CB HB sing N N 240 THR OG1 HG1 sing N N 241 THR CG2 HG21 sing N N 242 THR CG2 HG22 sing N N 243 THR CG2 HG23 sing N N 244 THR OXT HXT sing N N 245 TYR N CA sing N N 246 TYR N H sing N N 247 TYR N H2 sing N N 248 TYR CA C sing N N 249 TYR CA CB sing N N 250 TYR CA HA sing N N 251 TYR C O doub N N 252 TYR C OXT sing N N 253 TYR CB CG sing N N 254 TYR CB HB2 sing N N 255 TYR CB HB3 sing N N 256 TYR CG CD1 doub Y N 257 TYR CG CD2 sing Y N 258 TYR CD1 CE1 sing Y N 259 TYR CD1 HD1 sing N N 260 TYR CD2 CE2 doub Y N 261 TYR CD2 HD2 sing N N 262 TYR CE1 CZ doub Y N 263 TYR CE1 HE1 sing N N 264 TYR CE2 CZ sing Y N 265 TYR CE2 HE2 sing N N 266 TYR CZ OH sing N N 267 TYR OH HH sing N N 268 TYR OXT HXT sing N N 269 VAL N CA sing N N 270 VAL N H sing N N 271 VAL N H2 sing N N 272 VAL CA C sing N N 273 VAL CA CB sing N N 274 VAL CA HA sing N N 275 VAL C O doub N N 276 VAL C OXT sing N N 277 VAL CB CG1 sing N N 278 VAL CB CG2 sing N N 279 VAL CB HB sing N N 280 VAL CG1 HG11 sing N N 281 VAL CG1 HG12 sing N N 282 VAL CG1 HG13 sing N N 283 VAL CG2 HG21 sing N N 284 VAL CG2 HG22 sing N N 285 VAL CG2 HG23 sing N N 286 VAL OXT HXT sing N N 287 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian VNMRS 1 'Varian VNMRS' 700 Varian VNMRS 2 'Varian VNMRS' 600 Bruker DMX 3 'Bruker DMX' # _atom_sites.entry_id 2KB7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_