data_2KC7 # _entry.id 2KC7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KC7 pdb_00002kc7 10.2210/pdb2kc7/pdb RCSB RCSB100939 ? ? WWPDB D_1000100939 ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id BfR218 _pdbx_database_related.db_name TargetDB _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KC7 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-12-17 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Eletsky, A.' 1 'Wu, Y.' 2 'Sukumaran, D.' 3 'Lee, H.' 4 'Lee, D.Y.' 5 'Jiang, M.' 6 'Foote, E.L.' 7 'Xiao, R.' 8 'Nair, R.' 9 'Everett, J.K.' 10 'Swapna, G.V.T.' 11 'Acton, T.B.' 12 'Rost, B.' 13 'Montelione, G.T.' 14 'Prestegard, J.H.' 15 'Szyperski, T.' 16 'Northeast Structural Genomics Consortium (NESG)' 17 # _citation.id primary _citation.title 'Solution NMR structure of Bacteroides fragilis protein BF1650. Northeast Structural Genomics Consortium target BfR218' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Eletsky, A.' 1 ? primary 'Wu, Y.' 2 ? primary 'Sukumaran, D.' 3 ? primary 'Lee, H.' 4 ? primary 'Lee, D.Y.' 5 ? primary 'Jiang, M.' 6 ? primary 'Foote, E.L.' 7 ? primary 'Xiao, R.' 8 ? primary 'Nair, R.' 9 ? primary 'Everett, J.K.' 10 ? primary 'Swapna, G.V.T.' 11 ? primary 'Acton, T.B.' 12 ? primary 'Rost, B.' 13 ? primary 'Montelione, G.T.' 14 ? primary 'Prestegard, J.H.' 15 ? primary 'Szyperski, T.' 16 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description bfr218_protein _entity.formula_weight 11658.081 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDQLKTIKELINQGDIENALQALEEFLQTEPVGKDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKMVMDI LNFYNKDMYNQLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDQLKTIKELINQGDIENALQALEEFLQTEPVGKDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKMVMDI LNFYNKDMYNQLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier BfR218 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 GLN n 1 4 LEU n 1 5 LYS n 1 6 THR n 1 7 ILE n 1 8 LYS n 1 9 GLU n 1 10 LEU n 1 11 ILE n 1 12 ASN n 1 13 GLN n 1 14 GLY n 1 15 ASP n 1 16 ILE n 1 17 GLU n 1 18 ASN n 1 19 ALA n 1 20 LEU n 1 21 GLN n 1 22 ALA n 1 23 LEU n 1 24 GLU n 1 25 GLU n 1 26 PHE n 1 27 LEU n 1 28 GLN n 1 29 THR n 1 30 GLU n 1 31 PRO n 1 32 VAL n 1 33 GLY n 1 34 LYS n 1 35 ASP n 1 36 GLU n 1 37 ALA n 1 38 TYR n 1 39 TYR n 1 40 LEU n 1 41 MET n 1 42 GLY n 1 43 ASN n 1 44 ALA n 1 45 TYR n 1 46 ARG n 1 47 LYS n 1 48 LEU n 1 49 GLY n 1 50 ASP n 1 51 TRP n 1 52 GLN n 1 53 LYS n 1 54 ALA n 1 55 LEU n 1 56 ASN n 1 57 ASN n 1 58 TYR n 1 59 GLN n 1 60 SER n 1 61 ALA n 1 62 ILE n 1 63 GLU n 1 64 LEU n 1 65 ASN n 1 66 PRO n 1 67 ASP n 1 68 SER n 1 69 PRO n 1 70 ALA n 1 71 LEU n 1 72 GLN n 1 73 ALA n 1 74 ARG n 1 75 LYS n 1 76 MET n 1 77 VAL n 1 78 MET n 1 79 ASP n 1 80 ILE n 1 81 LEU n 1 82 ASN n 1 83 PHE n 1 84 TYR n 1 85 ASN n 1 86 LYS n 1 87 ASP n 1 88 MET n 1 89 TYR n 1 90 ASN n 1 91 GLN n 1 92 LEU n 1 93 GLU n 1 94 HIS n 1 95 HIS n 1 96 HIS n 1 97 HIS n 1 98 HIS n 1 99 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BF1650 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacteroides fragilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 817 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+ Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET 21-23C' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q64VS8_BACFR _struct_ref.pdbx_db_accession Q64VS8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDQLKTIKELINQGDIENALQALEEFLQTEPVGKDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKMVMDI LNFYNKDMYNQ ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KC7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 91 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q64VS8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 91 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 91 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KC7 LEU A 92 ? UNP Q64VS8 ? ? 'expression tag' 92 1 1 2KC7 GLU A 93 ? UNP Q64VS8 ? ? 'expression tag' 93 2 1 2KC7 HIS A 94 ? UNP Q64VS8 ? ? 'expression tag' 94 3 1 2KC7 HIS A 95 ? UNP Q64VS8 ? ? 'expression tag' 95 4 1 2KC7 HIS A 96 ? UNP Q64VS8 ? ? 'expression tag' 96 5 1 2KC7 HIS A 97 ? UNP Q64VS8 ? ? 'expression tag' 97 6 1 2KC7 HIS A 98 ? UNP Q64VS8 ? ? 'expression tag' 98 7 1 2KC7 HIS A 99 ? UNP Q64VS8 ? ? 'expression tag' 99 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC ali' 1 3 1 '2D 1H-13C HSQC aro' 1 4 1 '2D 1H-13C CT-HSQC ali' 1 5 1 '2D 1H-13C CT-HSQC aro' 1 6 1 '3D HNNCO' 1 7 1 '(4,3)D GFT CABCA(CO)NHN' 1 8 1 '(4,3)D GFT HNNCABCA' 1 9 1 '(4,3)D HABCAB(CO)NHN' 1 10 1 '(4,3)D GFT HCCH-COSY ali' 1 11 1 '(4,3)D GFT HCCH-COSY aro' 1 12 1 '3D (H)CCH-TOCSY ali' 1 13 1 '3D HN(CA)CO' 1 14 1 '3D 1H-15N,13C NOESY' 1 15 2 '2D 1H-13C CT-HSQC ali 28ms' 1 16 1 '2D MEXICO' 1 17 3 '2D 1H-15N HSQC' 1 18 3 '2D 1H-15N TROSY' 1 19 2 '2D 1H-15N HSQC' 1 20 2 '2D 1H-15N TROSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 215 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;20 mM MES-1, 200 mM sodium chloride-2, 5 mM calcium chloride-3, 10 mM DTT-4, 50 uM DSS-5, 0.02 % sodium azide-6, 1 X protease inhibitiors-7, 0.89 mM [U-100% 13C; U-100% 15N] bfr218 protein-8, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;20 mM MES-9, 200 mM sodium chloride-10, 5 mM calcium chloride-11, 10 mM DTT-12, 50 uM DSS-13, 0.02 % sodium azide-14, 1 X protease inhibitiors-15, 1 mM [U-5% 13C; U-100% 15N] bfr218 protein-16, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' ;20 mM MES-17, 200 mM sodium chloride-18, 5 mM calcium chloride-19, 10 mM DTT-20, 50 uM DSS-21, 0.02 % sodium azide-22, 1 X protease inhibitiors-23, 1 mM [U-5% 13C; U-100% 15N] bfr218 protein-24, 2.65 G/L PF1 PHAGE-25, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 750 Varian INOVA 1 'Varian INOVA' 600 Varian INOVA 2 'Varian INOVA' 600 Varian INOVA 3 'Varian INOVA' 500 Varian INOVA 4 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KC7 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;In explicit "water bath" ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KC7 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.329 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KC7 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VnmrJ 2.1B 1 Guntert processing PROSA 6.0.2 2 'Keller and Wuthrich' 'data analysis' CARA 1.8.4.2 3 'Keller and Wuthrich' 'chemical shift assignment' CARA 1.8.4.2 4 'Keller and Wuthrich' 'peak picking' CARA 1.8.4.2 5 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.3.0 6 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS 2007.068.09.07 7 'Huang, Tejero, Powers and Montelione' 'structure solution' AutoStructure 2.2.1 8 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 9 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2.1 10 'Bhattacharya and Montelione' 'structure validation' PSVS 1.3 11 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KC7 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KC7 _struct.title 'Solution NMR structure of Bacteroides fragilis protein BF1650. Northeast Structural Genomics Consortium target BfR218' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KC7 _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text ;tetratricopeptide repeat, all-alpha, GFT-NMR, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, unknown function ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 3 ? GLY A 14 ? GLN A 3 GLY A 14 1 ? 12 HELX_P HELX_P2 2 ASP A 15 ? GLU A 30 ? ASP A 15 GLU A 30 1 ? 16 HELX_P HELX_P3 3 GLY A 33 ? GLY A 49 ? GLY A 33 GLY A 49 1 ? 17 HELX_P HELX_P4 4 ASP A 50 ? ASN A 65 ? ASP A 50 ASN A 65 1 ? 16 HELX_P HELX_P5 5 PRO A 69 ? ASN A 85 ? PRO A 69 ASN A 85 1 ? 17 HELX_P HELX_P6 6 MET A 88 ? GLU A 93 ? MET A 88 GLU A 93 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2KC7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 HIS 99 99 99 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-01-13 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id MES-1 20 ? mM ? 1 'sodium chloride-2' 200 ? mM ? 1 'calcium chloride-3' 5 ? mM ? 1 DTT-4 10 ? mM ? 1 DSS-5 50 ? uM ? 1 'sodium azide-6' 0.02 ? % ? 1 'protease inhibitiors-7' ? ? % ? 1 'bfr218 protein-8' 0.89 ? mM '[U-100% 13C; U-100% 15N]' 1 MES-9 20 ? mM ? 2 'sodium chloride-10' 200 ? mM ? 2 'calcium chloride-11' 5 ? mM ? 2 DTT-12 10 ? mM ? 2 DSS-13 50 ? uM ? 2 'sodium azide-14' 0.02 ? % ? 2 'protease inhibitiors-15' ? ? % ? 2 'bfr218 protein-16' 1 ? mM '[U-5% 13C; U-100% 15N]' 2 MES-17 20 ? mM ? 3 'sodium chloride-18' 200 ? mM ? 3 'calcium chloride-19' 5 ? mM ? 3 DTT-20 10 ? mM ? 3 DSS-21 50 ? uM ? 3 'sodium azide-22' 0.02 ? % ? 3 'protease inhibitiors-23' ? ? % ? 3 'bfr218 protein-24' 1 ? mM '[U-5% 13C; U-100% 15N]' 3 phage-25 25 ? % ? 3 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KC7 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 200 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2343 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 473 _pdbx_nmr_constraints.NOE_long_range_total_count 631 _pdbx_nmr_constraints.NOE_medium_range_total_count 763 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 567 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 63 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 63 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 HA A PRO 31 ? ? HE3 A LYS 34 ? ? 1.33 2 11 HG23 A ILE 16 ? ? HB1 A ALA 44 ? ? 1.34 3 17 HA A PRO 31 ? ? HE3 A LYS 34 ? ? 1.21 4 18 HE21 A GLN 3 ? ? HD1 A PHE 26 ? ? 1.34 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 15 ? ? -90.77 48.33 2 1 TYR A 84 ? ? -75.64 -77.50 3 2 THR A 29 ? ? -94.15 -72.71 4 2 HIS A 95 ? ? -115.17 74.71 5 4 TYR A 84 ? ? -80.73 -73.21 6 4 ASP A 87 ? ? -78.01 -73.78 7 4 HIS A 94 ? ? -103.20 66.38 8 5 PRO A 69 ? ? -68.16 1.90 9 5 TYR A 84 ? ? -56.76 -76.06 10 5 ASN A 85 ? ? -134.46 -39.07 11 6 ASP A 2 ? ? -81.94 49.10 12 6 THR A 29 ? ? -97.42 -68.57 13 6 ASP A 67 ? ? -89.09 32.89 14 6 TYR A 84 ? ? -76.14 -76.40 15 6 HIS A 96 ? ? -175.58 111.45 16 7 TYR A 84 ? ? -69.26 -76.15 17 8 ASP A 67 ? ? -93.91 56.63 18 9 HIS A 97 ? ? -66.50 89.85 19 10 GLU A 30 ? ? -160.25 97.92 20 10 PRO A 69 ? ? -69.17 2.27 21 10 TYR A 84 ? ? -73.52 -72.31 22 11 TYR A 84 ? ? -74.84 -76.41 23 11 ASN A 90 ? ? 73.05 -9.01 24 11 HIS A 94 ? ? -87.85 -92.70 25 12 TYR A 84 ? ? -96.85 -68.19 26 12 ASN A 90 ? ? 80.50 -11.18 27 13 ASP A 2 ? ? -67.00 99.01 28 13 TYR A 84 ? ? -84.48 -91.02 29 13 HIS A 96 ? ? -72.87 -85.84 30 13 HIS A 97 ? ? -175.43 -177.49 31 14 TYR A 84 ? ? -62.90 -71.08 32 14 ASP A 87 ? ? -129.16 -73.93 33 14 ASN A 90 ? ? 169.03 -56.50 34 15 ASP A 2 ? ? -171.82 105.18 35 15 TYR A 84 ? ? -71.19 -91.89 36 16 ASP A 67 ? ? -86.48 32.48 37 16 TYR A 84 ? ? -74.66 -73.90 38 16 HIS A 97 ? ? -157.87 85.39 39 20 TYR A 84 ? ? -86.61 -75.24 40 20 ASN A 90 ? ? 75.00 -1.24 #