data_2KC9 # _entry.id 2KC9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KC9 pdb_00002kc9 10.2210/pdb2kc9/pdb RCSB RCSB100941 ? ? WWPDB D_1000100941 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2KC8 _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'Structure of E. coli toxin RelE (R81A/R83A) mutant in complex with antitoxin RelBc (K47-L79) peptide' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KC9 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-12-17 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, G.' 1 'Zhang, Y.' 2 'Inouye, M.' 3 'Ikura, M.' 4 # _citation.id primary _citation.title ;Inhibitory mechanism of Escherichia coli RelE-RelB toxin-antitoxin module involves a helix displacement near an mRNA interferase active site. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 284 _citation.page_first 14628 _citation.page_last 14636 _citation.year 2009 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19297318 _citation.pdbx_database_id_DOI 10.1074/jbc.M809656200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, G.Y.' 1 ? primary 'Zhang, Y.' 2 ? primary 'Inouye, M.' 3 ? primary 'Ikura, M.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Toxin relE' _entity.formula_weight 11356.294 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'R81A, R83A' _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVIS VGKAEASEVYSEAVKRIL ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVIS VGKAEASEVYSEAVKRIL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 TYR n 1 7 PHE n 1 8 LEU n 1 9 ASP n 1 10 PHE n 1 11 ASP n 1 12 GLU n 1 13 ARG n 1 14 ALA n 1 15 LEU n 1 16 LYS n 1 17 GLU n 1 18 TRP n 1 19 ARG n 1 20 LYS n 1 21 LEU n 1 22 GLY n 1 23 SER n 1 24 THR n 1 25 VAL n 1 26 ARG n 1 27 GLU n 1 28 GLN n 1 29 LEU n 1 30 LYS n 1 31 LYS n 1 32 LYS n 1 33 LEU n 1 34 VAL n 1 35 GLU n 1 36 VAL n 1 37 LEU n 1 38 GLU n 1 39 SER n 1 40 PRO n 1 41 ARG n 1 42 ILE n 1 43 GLU n 1 44 ALA n 1 45 ASN n 1 46 LYS n 1 47 LEU n 1 48 ARG n 1 49 GLY n 1 50 MET n 1 51 PRO n 1 52 ASP n 1 53 CYS n 1 54 TYR n 1 55 LYS n 1 56 ILE n 1 57 LYS n 1 58 LEU n 1 59 ARG n 1 60 SER n 1 61 SER n 1 62 GLY n 1 63 TYR n 1 64 ARG n 1 65 LEU n 1 66 VAL n 1 67 TYR n 1 68 GLN n 1 69 VAL n 1 70 ILE n 1 71 ASP n 1 72 GLU n 1 73 LYS n 1 74 VAL n 1 75 VAL n 1 76 VAL n 1 77 PHE n 1 78 VAL n 1 79 ILE n 1 80 SER n 1 81 VAL n 1 82 GLY n 1 83 LYS n 1 84 ALA n 1 85 GLU n 1 86 ALA n 1 87 SER n 1 88 GLU n 1 89 VAL n 1 90 TYR n 1 91 SER n 1 92 GLU n 1 93 ALA n 1 94 VAL n 1 95 LYS n 1 96 ARG n 1 97 ILE n 1 98 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'relE, b1563, JW1555' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K-12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant DE3 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET28a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'RelE is expressed with his-tag fusion. The his-tag is removed by thrombin afterward' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RELE_ECOLI _struct_ref.pdbx_db_accession P0C077 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK RERSEVYSEAVKRIL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KC9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 98 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0C077 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 95 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 95 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KC9 GLY A 1 ? UNP P0C077 ? ? 'expression tag' -2 1 1 2KC9 SER A 2 ? UNP P0C077 ? ? 'expression tag' -1 2 1 2KC9 HIS A 3 ? UNP P0C077 ? ? 'expression tag' 0 3 1 2KC9 ALA A 84 ? UNP P0C077 ARG 81 'engineered mutation' 81 4 1 2KC9 ALA A 86 ? UNP P0C077 ARG 83 'engineered mutation' 83 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCACB' 1 3 1 '3D C(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D H(CCO)NH' 1 6 1 '3D 1H-15N NOESY' 1 7 2 '2D 1H-13C HSQC' 1 8 2 '3D HCCH-TOCSY' 1 9 2 '3D HCCH-COSY' 1 10 2 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.5 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 296.5 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.5 mM [U-13C; U-15N] RelE-1, 25 mM sodium phosphate-2, 500 mM sodium chloride-3, 1 mM DTT-4, 0.5 mM sodium azide-5, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' '0.5 mM [U-13C; U-15N] RelE-6, 25 mM sodium phosphate-7, 500 mM sodium chloride-8, 1 mM DTT-9, 0.5 mM sodium azide-10, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Varian INOVA 1 'Varian INOVA' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KC9 _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 3.099 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KC9 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 3.839 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.248 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method CNS # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KC9 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 2.0 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Bartels et al.' 'data analysis' XEASY ? 3 'Bartels et al.' 'peak picking' XEASY ? 4 'Bartels et al.' 'chemical shift assignment' XEASY ? 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 6 'Guntert, Mumenthaler and Wuthrich' 'automated noe peak assignments' CYANA 2.1 7 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.1 8 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.1 9 'Koradi, Billeter and Wuthrich' 'structure analysis' MOLMOL ? 10 'Laskowski and MacArthur' 'data analysis' ProcheckNMR ? 11 Varian collection VNMR ? 12 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'There is a related deposition of this protein in complex with a antitoxin peptide' _exptl.entry_id 2KC9 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KC9 _struct.title 'Structure of E. coli toxin RelE (R81A/R83A) mutant in the free state' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KC9 _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'RelE, Toxin, Repressor, Stress response, Transcription, Transcription regulation' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 11 ? LEU A 21 ? ASP A 8 LEU A 18 1 ? 11 HELX_P HELX_P2 2 GLY A 22 ? LEU A 37 ? GLY A 19 LEU A 34 1 ? 16 HELX_P HELX_P3 3 SER A 87 ? ILE A 97 ? SER A 84 ILE A 94 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 7 ? PHE A 10 ? PHE A 4 PHE A 7 A 2 VAL A 75 ? GLY A 82 ? VAL A 72 GLY A 79 A 3 ARG A 64 ? ILE A 70 ? ARG A 61 ILE A 67 A 4 CYS A 53 ? LYS A 57 ? CYS A 50 LYS A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 7 ? N PHE A 4 O VAL A 76 ? O VAL A 73 A 2 3 O PHE A 77 ? O PHE A 74 N GLN A 68 ? N GLN A 65 A 3 4 O TYR A 67 ? O TYR A 64 N TYR A 54 ? N TYR A 51 # _atom_sites.entry_id 2KC9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 ALA 5 2 2 ALA ALA A . n A 1 6 TYR 6 3 3 TYR TYR A . n A 1 7 PHE 7 4 4 PHE PHE A . n A 1 8 LEU 8 5 5 LEU LEU A . n A 1 9 ASP 9 6 6 ASP ASP A . n A 1 10 PHE 10 7 7 PHE PHE A . n A 1 11 ASP 11 8 8 ASP ASP A . n A 1 12 GLU 12 9 9 GLU GLU A . n A 1 13 ARG 13 10 10 ARG ARG A . n A 1 14 ALA 14 11 11 ALA ALA A . n A 1 15 LEU 15 12 12 LEU LEU A . n A 1 16 LYS 16 13 13 LYS LYS A . n A 1 17 GLU 17 14 14 GLU GLU A . n A 1 18 TRP 18 15 15 TRP TRP A . n A 1 19 ARG 19 16 16 ARG ARG A . n A 1 20 LYS 20 17 17 LYS LYS A . n A 1 21 LEU 21 18 18 LEU LEU A . n A 1 22 GLY 22 19 19 GLY GLY A . n A 1 23 SER 23 20 20 SER SER A . n A 1 24 THR 24 21 21 THR THR A . n A 1 25 VAL 25 22 22 VAL VAL A . n A 1 26 ARG 26 23 23 ARG ARG A . n A 1 27 GLU 27 24 24 GLU GLU A . n A 1 28 GLN 28 25 25 GLN GLN A . n A 1 29 LEU 29 26 26 LEU LEU A . n A 1 30 LYS 30 27 27 LYS LYS A . n A 1 31 LYS 31 28 28 LYS LYS A . n A 1 32 LYS 32 29 29 LYS LYS A . n A 1 33 LEU 33 30 30 LEU LEU A . n A 1 34 VAL 34 31 31 VAL VAL A . n A 1 35 GLU 35 32 32 GLU GLU A . n A 1 36 VAL 36 33 33 VAL VAL A . n A 1 37 LEU 37 34 34 LEU LEU A . n A 1 38 GLU 38 35 35 GLU GLU A . n A 1 39 SER 39 36 36 SER SER A . n A 1 40 PRO 40 37 37 PRO PRO A . n A 1 41 ARG 41 38 38 ARG ARG A . n A 1 42 ILE 42 39 39 ILE ILE A . n A 1 43 GLU 43 40 40 GLU GLU A . n A 1 44 ALA 44 41 41 ALA ALA A . n A 1 45 ASN 45 42 42 ASN ASN A . n A 1 46 LYS 46 43 43 LYS LYS A . n A 1 47 LEU 47 44 44 LEU LEU A . n A 1 48 ARG 48 45 45 ARG ARG A . n A 1 49 GLY 49 46 46 GLY GLY A . n A 1 50 MET 50 47 47 MET MET A . n A 1 51 PRO 51 48 48 PRO PRO A . n A 1 52 ASP 52 49 49 ASP ASP A . n A 1 53 CYS 53 50 50 CYS CYS A . n A 1 54 TYR 54 51 51 TYR TYR A . n A 1 55 LYS 55 52 52 LYS LYS A . n A 1 56 ILE 56 53 53 ILE ILE A . n A 1 57 LYS 57 54 54 LYS LYS A . n A 1 58 LEU 58 55 55 LEU LEU A . n A 1 59 ARG 59 56 56 ARG ARG A . n A 1 60 SER 60 57 57 SER SER A . n A 1 61 SER 61 58 58 SER SER A . n A 1 62 GLY 62 59 59 GLY GLY A . n A 1 63 TYR 63 60 60 TYR TYR A . n A 1 64 ARG 64 61 61 ARG ARG A . n A 1 65 LEU 65 62 62 LEU LEU A . n A 1 66 VAL 66 63 63 VAL VAL A . n A 1 67 TYR 67 64 64 TYR TYR A . n A 1 68 GLN 68 65 65 GLN GLN A . n A 1 69 VAL 69 66 66 VAL VAL A . n A 1 70 ILE 70 67 67 ILE ILE A . n A 1 71 ASP 71 68 68 ASP ASP A . n A 1 72 GLU 72 69 69 GLU GLU A . n A 1 73 LYS 73 70 70 LYS LYS A . n A 1 74 VAL 74 71 71 VAL VAL A . n A 1 75 VAL 75 72 72 VAL VAL A . n A 1 76 VAL 76 73 73 VAL VAL A . n A 1 77 PHE 77 74 74 PHE PHE A . n A 1 78 VAL 78 75 75 VAL VAL A . n A 1 79 ILE 79 76 76 ILE ILE A . n A 1 80 SER 80 77 77 SER SER A . n A 1 81 VAL 81 78 78 VAL VAL A . n A 1 82 GLY 82 79 79 GLY GLY A . n A 1 83 LYS 83 80 80 LYS LYS A . n A 1 84 ALA 84 81 81 ALA ALA A . n A 1 85 GLU 85 82 82 GLU GLU A . n A 1 86 ALA 86 83 83 ALA ALA A . n A 1 87 SER 87 84 84 SER SER A . n A 1 88 GLU 88 85 85 GLU GLU A . n A 1 89 VAL 89 86 86 VAL VAL A . n A 1 90 TYR 90 87 87 TYR TYR A . n A 1 91 SER 91 88 88 SER SER A . n A 1 92 GLU 92 89 89 GLU GLU A . n A 1 93 ALA 93 90 90 ALA ALA A . n A 1 94 VAL 94 91 91 VAL VAL A . n A 1 95 LYS 95 92 92 LYS LYS A . n A 1 96 ARG 96 93 93 ARG ARG A . n A 1 97 ILE 97 94 94 ILE ILE A . n A 1 98 LEU 98 95 95 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-03-17 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.008 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.001 _pdbx_nmr_ensemble_rms.entry_id 2KC9 _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id RelE-1 0.5 ? mM '[U-13C; U-15N]' 1 'sodium phosphate-2' 25 ? mM ? 1 'sodium chloride-3' 500 ? mM ? 1 DTT-4 1 ? mM ? 1 'sodium azide-5' 0.5 ? mM ? 1 RelE-6 0.5 ? mM '[U-13C; U-15N]' 2 'sodium phosphate-7' 25 ? mM ? 2 'sodium chloride-8' 500 ? mM ? 2 DTT-9 1 ? mM ? 2 'sodium azide-10' 0.5 ? mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KC9 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 80 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2440 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 1821 _pdbx_nmr_constraints.NOE_long_range_total_count 790 _pdbx_nmr_constraints.NOE_medium_range_total_count 481 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 550 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 62 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 62 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 36 ? ? -160.16 77.92 2 1 ASP A 49 ? ? -149.22 55.54 3 1 SER A 57 ? ? -71.68 -85.72 4 2 SER A 36 ? ? -162.55 80.21 5 2 ARG A 38 ? ? -90.19 36.15 6 2 PRO A 48 ? ? -63.18 95.13 7 2 ARG A 56 ? ? 74.27 -62.27 8 3 SER A 36 ? ? -157.47 67.47 9 3 ARG A 38 ? ? -78.28 25.75 10 3 PRO A 48 ? ? -63.03 94.40 11 3 ALA A 83 ? ? -144.77 -67.13 12 3 SER A 84 ? ? -151.53 26.32 13 4 SER A 36 ? ? -162.90 77.66 14 4 PRO A 48 ? ? -58.43 90.43 15 5 SER A 36 ? ? -164.52 78.78 16 5 ARG A 38 ? ? -83.62 34.16 17 5 PRO A 48 ? ? -59.87 95.42 18 5 SER A 57 ? ? -165.57 -38.24 19 5 ALA A 83 ? ? -149.44 -61.62 20 6 SER A 36 ? ? -155.20 70.99 21 6 PRO A 48 ? ? -63.92 90.88 22 6 ILE A 94 ? ? -93.28 -62.99 23 7 SER A 36 ? ? -159.29 62.19 24 7 SER A 84 ? ? 72.89 35.92 25 8 SER A 20 ? ? -106.50 -60.47 26 8 SER A 36 ? ? -160.10 77.50 27 8 ARG A 38 ? ? -83.79 40.96 28 8 PRO A 48 ? ? -67.20 95.13 29 8 SER A 58 ? ? -156.05 -45.53 30 8 ALA A 83 ? ? -130.42 -63.27 31 8 SER A 84 ? ? -161.55 22.99 32 9 SER A 36 ? ? -158.42 76.66 33 9 PRO A 48 ? ? -62.07 95.16 34 9 ALA A 83 ? ? -127.44 -69.29 35 9 SER A 84 ? ? -159.96 24.18 36 10 SER A 36 ? ? -158.09 74.46 37 10 ARG A 38 ? ? -88.12 32.78 38 11 SER A 36 ? ? -161.72 75.81 39 11 ARG A 38 ? ? -80.29 43.30 40 12 SER A 36 ? ? -154.20 74.19 41 12 ARG A 38 ? ? -90.22 38.69 42 12 PRO A 48 ? ? -51.75 -71.70 43 12 SER A 58 ? ? 71.82 -43.88 44 12 GLU A 82 ? ? -134.70 -37.31 45 12 ALA A 83 ? ? -146.69 -77.08 46 13 SER A 36 ? ? -152.37 69.41 47 13 ARG A 38 ? ? -90.79 37.94 48 13 PRO A 48 ? ? -65.65 99.08 49 13 ARG A 56 ? ? -68.44 78.80 50 13 SER A 57 ? ? 172.63 -49.96 51 13 GLU A 82 ? ? -94.63 -68.00 52 13 ALA A 83 ? ? -129.30 -59.82 53 14 SER A 36 ? ? -154.81 63.72 54 14 ARG A 38 ? ? -92.02 40.20 55 14 PRO A 48 ? ? -57.92 89.43 56 14 ALA A 83 ? ? -172.11 -51.33 57 15 SER A 36 ? ? -155.27 69.67 58 15 ARG A 38 ? ? -89.04 38.70 59 15 PRO A 48 ? ? -65.25 98.90 60 15 ALA A 83 ? ? -141.62 -66.80 61 15 SER A 84 ? ? -153.49 20.32 62 16 SER A 20 ? ? -163.74 -60.85 63 16 SER A 36 ? ? -162.05 76.04 64 16 ARG A 38 ? ? -91.68 40.91 65 16 ARG A 45 ? ? -63.15 -74.28 66 16 PRO A 48 ? ? -59.91 99.11 67 16 SER A 58 ? ? 69.51 -173.69 68 16 ALA A 81 ? ? -89.58 -78.35 69 16 GLU A 82 ? ? 58.35 -45.04 70 17 PRO A 48 ? ? -69.40 95.76 71 17 SER A 58 ? ? -134.78 -36.03 72 17 ALA A 83 ? ? 72.87 -87.84 73 17 SER A 84 ? ? -153.24 7.24 74 18 SER A 36 ? ? -152.60 73.95 75 18 ARG A 38 ? ? -87.51 41.45 76 18 ASP A 49 ? ? -154.66 83.65 77 19 ARG A 38 ? ? -84.48 39.22 78 19 PRO A 48 ? ? -67.88 -74.35 79 19 SER A 57 ? ? 171.61 -39.75 80 19 ALA A 83 ? ? -178.19 -76.77 81 20 SER A 36 ? ? -157.57 77.58 82 20 ALA A 83 ? ? -137.68 -54.55 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 61 ? ? 0.080 'SIDE CHAIN' 2 3 ARG A 38 ? ? 0.083 'SIDE CHAIN' 3 12 ARG A 61 ? ? 0.109 'SIDE CHAIN' 4 16 ARG A 10 ? ? 0.081 'SIDE CHAIN' 5 19 ARG A 16 ? ? 0.075 'SIDE CHAIN' 6 20 ARG A 10 ? ? 0.087 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 2 Y 1 A GLY -2 ? A GLY 1 5 2 Y 1 A SER -1 ? A SER 2 6 2 Y 1 A HIS 0 ? A HIS 3 7 3 Y 1 A GLY -2 ? A GLY 1 8 3 Y 1 A SER -1 ? A SER 2 9 3 Y 1 A HIS 0 ? A HIS 3 10 4 Y 1 A GLY -2 ? A GLY 1 11 4 Y 1 A SER -1 ? A SER 2 12 4 Y 1 A HIS 0 ? A HIS 3 13 5 Y 1 A GLY -2 ? A GLY 1 14 5 Y 1 A SER -1 ? A SER 2 15 5 Y 1 A HIS 0 ? A HIS 3 16 6 Y 1 A GLY -2 ? A GLY 1 17 6 Y 1 A SER -1 ? A SER 2 18 6 Y 1 A HIS 0 ? A HIS 3 19 7 Y 1 A GLY -2 ? A GLY 1 20 7 Y 1 A SER -1 ? A SER 2 21 7 Y 1 A HIS 0 ? A HIS 3 22 8 Y 1 A GLY -2 ? A GLY 1 23 8 Y 1 A SER -1 ? A SER 2 24 8 Y 1 A HIS 0 ? A HIS 3 25 9 Y 1 A GLY -2 ? A GLY 1 26 9 Y 1 A SER -1 ? A SER 2 27 9 Y 1 A HIS 0 ? A HIS 3 28 10 Y 1 A GLY -2 ? A GLY 1 29 10 Y 1 A SER -1 ? A SER 2 30 10 Y 1 A HIS 0 ? A HIS 3 31 11 Y 1 A GLY -2 ? A GLY 1 32 11 Y 1 A SER -1 ? A SER 2 33 11 Y 1 A HIS 0 ? A HIS 3 34 12 Y 1 A GLY -2 ? A GLY 1 35 12 Y 1 A SER -1 ? A SER 2 36 12 Y 1 A HIS 0 ? A HIS 3 37 13 Y 1 A GLY -2 ? A GLY 1 38 13 Y 1 A SER -1 ? A SER 2 39 13 Y 1 A HIS 0 ? A HIS 3 40 14 Y 1 A GLY -2 ? A GLY 1 41 14 Y 1 A SER -1 ? A SER 2 42 14 Y 1 A HIS 0 ? A HIS 3 43 15 Y 1 A GLY -2 ? A GLY 1 44 15 Y 1 A SER -1 ? A SER 2 45 15 Y 1 A HIS 0 ? A HIS 3 46 16 Y 1 A GLY -2 ? A GLY 1 47 16 Y 1 A SER -1 ? A SER 2 48 16 Y 1 A HIS 0 ? A HIS 3 49 17 Y 1 A GLY -2 ? A GLY 1 50 17 Y 1 A SER -1 ? A SER 2 51 17 Y 1 A HIS 0 ? A HIS 3 52 18 Y 1 A GLY -2 ? A GLY 1 53 18 Y 1 A SER -1 ? A SER 2 54 18 Y 1 A HIS 0 ? A HIS 3 55 19 Y 1 A GLY -2 ? A GLY 1 56 19 Y 1 A SER -1 ? A SER 2 57 19 Y 1 A HIS 0 ? A HIS 3 58 20 Y 1 A GLY -2 ? A GLY 1 59 20 Y 1 A SER -1 ? A SER 2 60 20 Y 1 A HIS 0 ? A HIS 3 #