data_2KCW # _entry.id 2KCW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.323 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2KCW RCSB RCSB100963 WWPDB D_1000100963 BMRB 16098 # _pdbx_database_related.db_id 16098 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KCW _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-12-30 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lu, J.' 1 'Wang, X.' 2 'Jin, C.' 3 # _citation.id primary _citation.title 'Solution structure of Apo-YjaB from Escherichia coli' _citation.journal_abbrev Proteins _citation.journal_volume 76 _citation.page_first 261 _citation.page_last 265 _citation.year 2009 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19343803 _citation.pdbx_database_id_DOI 10.1002/prot.22407 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lu, J.' 1 ? primary 'Wang, X.' 2 ? primary 'Xia, B.' 3 ? primary 'Jin, C.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized acetyltransferase yjaB' _entity.formula_weight 16464.660 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.3.1.- _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVISIRRSRHEEGEELVAIWCRSVDATHDFLSAEYRTELEDLVRSFLPEAPLWVAVNERDQPVGFMLLSGQHMDALFIDP DVRGCGVGRVLVEHALSMAPELTTNVNEQNEQAVGFYKKVGFKVTGRSEVDDLGKPYPLLNLAYVGA ; _entity_poly.pdbx_seq_one_letter_code_can ;MVISIRRSRHEEGEELVAIWCRSVDATHDFLSAEYRTELEDLVRSFLPEAPLWVAVNERDQPVGFMLLSGQHMDALFIDP DVRGCGVGRVLVEHALSMAPELTTNVNEQNEQAVGFYKKVGFKVTGRSEVDDLGKPYPLLNLAYVGA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 ILE n 1 4 SER n 1 5 ILE n 1 6 ARG n 1 7 ARG n 1 8 SER n 1 9 ARG n 1 10 HIS n 1 11 GLU n 1 12 GLU n 1 13 GLY n 1 14 GLU n 1 15 GLU n 1 16 LEU n 1 17 VAL n 1 18 ALA n 1 19 ILE n 1 20 TRP n 1 21 CYS n 1 22 ARG n 1 23 SER n 1 24 VAL n 1 25 ASP n 1 26 ALA n 1 27 THR n 1 28 HIS n 1 29 ASP n 1 30 PHE n 1 31 LEU n 1 32 SER n 1 33 ALA n 1 34 GLU n 1 35 TYR n 1 36 ARG n 1 37 THR n 1 38 GLU n 1 39 LEU n 1 40 GLU n 1 41 ASP n 1 42 LEU n 1 43 VAL n 1 44 ARG n 1 45 SER n 1 46 PHE n 1 47 LEU n 1 48 PRO n 1 49 GLU n 1 50 ALA n 1 51 PRO n 1 52 LEU n 1 53 TRP n 1 54 VAL n 1 55 ALA n 1 56 VAL n 1 57 ASN n 1 58 GLU n 1 59 ARG n 1 60 ASP n 1 61 GLN n 1 62 PRO n 1 63 VAL n 1 64 GLY n 1 65 PHE n 1 66 MET n 1 67 LEU n 1 68 LEU n 1 69 SER n 1 70 GLY n 1 71 GLN n 1 72 HIS n 1 73 MET n 1 74 ASP n 1 75 ALA n 1 76 LEU n 1 77 PHE n 1 78 ILE n 1 79 ASP n 1 80 PRO n 1 81 ASP n 1 82 VAL n 1 83 ARG n 1 84 GLY n 1 85 CYS n 1 86 GLY n 1 87 VAL n 1 88 GLY n 1 89 ARG n 1 90 VAL n 1 91 LEU n 1 92 VAL n 1 93 GLU n 1 94 HIS n 1 95 ALA n 1 96 LEU n 1 97 SER n 1 98 MET n 1 99 ALA n 1 100 PRO n 1 101 GLU n 1 102 LEU n 1 103 THR n 1 104 THR n 1 105 ASN n 1 106 VAL n 1 107 ASN n 1 108 GLU n 1 109 GLN n 1 110 ASN n 1 111 GLU n 1 112 GLN n 1 113 ALA n 1 114 VAL n 1 115 GLY n 1 116 PHE n 1 117 TYR n 1 118 LYS n 1 119 LYS n 1 120 VAL n 1 121 GLY n 1 122 PHE n 1 123 LYS n 1 124 VAL n 1 125 THR n 1 126 GLY n 1 127 ARG n 1 128 SER n 1 129 GLU n 1 130 VAL n 1 131 ASP n 1 132 ASP n 1 133 LEU n 1 134 GLY n 1 135 LYS n 1 136 PRO n 1 137 TYR n 1 138 PRO n 1 139 LEU n 1 140 LEU n 1 141 ASN n 1 142 LEU n 1 143 ALA n 1 144 TYR n 1 145 VAL n 1 146 GLY n 1 147 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene yjaB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET28a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YJAB_ECOLI _struct_ref.pdbx_db_accession P09163 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVISIRRSRHEEGEELVAIWCRSVDATHDFLSAEYRTELEDLVRSFLPEAPLWVAVNERDQPVGFMLLSGQHMDALFIDP DVRGCGVGRVLVEHALSMAPELTTNVNEQNEQAVGFYKKVGFKVTGRSEVDDLGKPYPLLNLAYVGA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KCW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 147 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P09163 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 147 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 147 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-15N NOESY' 1 3 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 130 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '30mM TRIS, 100mM sodium chloride, 10mM DTT, 1 mM [U-13C; U-15N] YjaB protein, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KCW _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 21 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KCW _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KCW _pdbx_nmr_representative.selection_criteria 'minimized average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2.1 1 'Johnson, One Moon Scientific' 'data analysis' NMRView 5 2 'Bruker Biospin' collection XwinNMR 3.5 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.0 4 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo and Kollm' refinement Amber 7 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KCW _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KCW _struct.title 'Solution structure of Apo-form YjaB from Escherichia coli' _struct.pdbx_descriptor 'Uncharacterized acetyltransferase yjaB (E.C.2.3.1.-)' _struct.pdbx_model_details 'minimized average, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KCW _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'GNAT fold, Acyltransferase, Transferase' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 12 ? HIS A 28 ? GLU A 12 HIS A 28 1 ? 17 HELX_P HELX_P2 2 SER A 32 ? SER A 45 ? SER A 32 SER A 45 1 ? 14 HELX_P HELX_P3 3 ASP A 79 ? GLY A 84 ? ASP A 79 GLY A 84 1 ? 6 HELX_P HELX_P4 4 GLY A 86 ? ALA A 99 ? GLY A 86 ALA A 99 1 ? 14 HELX_P HELX_P5 5 ASN A 110 ? GLY A 121 ? ASN A 110 GLY A 121 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 3 ? ARG A 7 ? ILE A 3 ARG A 7 A 2 TRP A 53 ? ASN A 57 ? TRP A 53 ASN A 57 A 3 PRO A 62 ? SER A 69 ? PRO A 62 SER A 69 A 4 HIS A 72 ? ILE A 78 ? HIS A 72 ILE A 78 A 5 THR A 103 ? ASN A 107 ? THR A 103 ASN A 107 A 6 LEU A 139 ? TYR A 144 ? LEU A 139 TYR A 144 A 7 PHE A 122 ? ARG A 127 ? PHE A 122 ARG A 127 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 6 ? N ARG A 6 O VAL A 54 ? O VAL A 54 A 2 3 N ALA A 55 ? N ALA A 55 O VAL A 63 ? O VAL A 63 A 3 4 N PHE A 65 ? N PHE A 65 O PHE A 77 ? O PHE A 77 A 4 5 N MET A 73 ? N MET A 73 O THR A 103 ? O THR A 103 A 5 6 N THR A 104 ? N THR A 104 O LEU A 142 ? O LEU A 142 A 6 7 O ALA A 143 ? O ALA A 143 N LYS A 123 ? N LYS A 123 # _atom_sites.entry_id 2KCW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 TRP 53 53 53 TRP TRP A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 TYR 144 144 144 TYR TYR A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 ALA 147 147 147 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-05-05 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Source and taxonomy' 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id TRIS 30 ? mM ? 1 'sodium chloride' 100 ? mM ? 1 DTT 10 ? mM ? 1 'YjaB protein' 1 ? mM '[U-13C; U-15N]' 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 HH A TYR 35 ? ? OD2 A ASP 131 ? ? 1.60 2 6 HH A TYR 35 ? ? OD2 A ASP 131 ? ? 1.58 3 14 HH A TYR 35 ? ? OD2 A ASP 131 ? ? 1.60 4 21 HH A TYR 35 ? ? OD2 A ASP 131 ? ? 1.58 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 N _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLY _pdbx_validate_rmsd_bond.auth_seq_id_1 146 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CA _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLY _pdbx_validate_rmsd_bond.auth_seq_id_2 146 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.567 _pdbx_validate_rmsd_bond.bond_target_value 1.456 _pdbx_validate_rmsd_bond.bond_deviation 0.111 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.015 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH2 A ARG 9 ? ? 114.71 120.30 -5.59 0.50 N 2 1 NH1 A ARG 22 ? ? CZ A ARG 22 ? ? NH2 A ARG 22 ? ? 126.46 119.40 7.06 1.10 N 3 1 NE A ARG 22 ? ? CZ A ARG 22 ? ? NH2 A ARG 22 ? ? 112.37 120.30 -7.93 0.50 N 4 1 CB A TYR 35 ? ? CG A TYR 35 ? ? CD2 A TYR 35 ? ? 114.91 121.00 -6.09 0.60 N 5 1 NE A ARG 44 ? ? CZ A ARG 44 ? ? NH2 A ARG 44 ? ? 114.85 120.30 -5.45 0.50 N 6 1 CG A ARG 59 ? ? CD A ARG 59 ? ? NE A ARG 59 ? ? 99.09 111.80 -12.71 2.10 N 7 1 NH1 A ARG 59 ? ? CZ A ARG 59 ? ? NH2 A ARG 59 ? ? 127.32 119.40 7.92 1.10 N 8 1 NE A ARG 59 ? ? CZ A ARG 59 ? ? NH2 A ARG 59 ? ? 111.07 120.30 -9.23 0.50 N 9 1 CA A MET 66 ? ? CB A MET 66 ? ? CG A MET 66 ? ? 130.70 113.30 17.40 1.70 N 10 1 NE A ARG 83 ? ? CZ A ARG 83 ? ? NH2 A ARG 83 ? ? 115.07 120.30 -5.23 0.50 N 11 1 NE A ARG 89 ? ? CZ A ARG 89 ? ? NH2 A ARG 89 ? ? 115.69 120.30 -4.61 0.50 N 12 1 CD A ARG 127 ? ? NE A ARG 127 ? ? CZ A ARG 127 ? ? 133.46 123.60 9.86 1.40 N 13 1 NE A ARG 127 ? ? CZ A ARG 127 ? ? NH2 A ARG 127 ? ? 113.73 120.30 -6.57 0.50 N 14 1 CB A TYR 144 ? ? CG A TYR 144 ? ? CD2 A TYR 144 ? ? 115.92 121.00 -5.08 0.60 N 15 1 CA A VAL 145 ? ? C A VAL 145 ? ? O A VAL 145 ? ? 100.82 120.10 -19.28 2.10 N 16 1 O A VAL 145 ? ? C A VAL 145 ? ? N A GLY 146 ? ? 135.48 123.20 12.28 1.70 Y 17 1 C A VAL 145 ? ? N A GLY 146 ? ? CA A GLY 146 ? ? 151.44 122.30 29.14 2.10 Y 18 1 N A GLY 146 ? ? CA A GLY 146 ? ? C A GLY 146 ? ? 132.07 113.10 18.97 2.50 N 19 1 CA A GLY 146 ? ? C A GLY 146 ? ? N A ALA 147 ? ? 100.48 117.20 -16.72 2.20 Y 20 1 N A ALA 147 ? ? CA A ALA 147 ? ? CB A ALA 147 ? ? 99.16 110.10 -10.94 1.40 N 21 6 NE A ARG 44 ? ? CZ A ARG 44 ? ? NH2 A ARG 44 ? ? 117.16 120.30 -3.14 0.50 N 22 8 NE A ARG 22 ? ? CZ A ARG 22 ? ? NH2 A ARG 22 ? ? 117.08 120.30 -3.22 0.50 N 23 10 NE A ARG 127 ? ? CZ A ARG 127 ? ? NH2 A ARG 127 ? ? 116.96 120.30 -3.34 0.50 N 24 14 NE A ARG 22 ? ? CZ A ARG 22 ? ? NH2 A ARG 22 ? ? 117.12 120.30 -3.18 0.50 N 25 17 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH1 A ARG 36 ? ? 123.43 120.30 3.13 0.50 N 26 21 NE A ARG 127 ? ? CZ A ARG 127 ? ? NH2 A ARG 127 ? ? 117.23 120.30 -3.07 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 46 ? ? -140.09 -56.29 2 1 ASP A 132 ? ? -161.16 -47.88 3 2 PHE A 46 ? ? -135.24 -56.45 4 2 ASP A 132 ? ? -161.81 -46.52 5 2 PRO A 136 ? ? -78.11 43.94 6 3 PHE A 46 ? ? -136.09 -56.77 7 3 ASP A 131 ? ? -73.45 -73.39 8 3 ASP A 132 ? ? -165.04 -40.82 9 3 PRO A 136 ? ? -64.73 42.38 10 4 PHE A 46 ? ? -136.06 -56.28 11 4 ASN A 110 ? ? -105.71 69.51 12 4 ASP A 132 ? ? -160.40 -38.45 13 5 PHE A 46 ? ? -137.40 -54.86 14 5 PRO A 51 ? ? -80.17 45.51 15 5 ASP A 132 ? ? -161.07 -37.43 16 5 PRO A 136 ? ? -60.43 71.05 17 5 PRO A 138 ? ? -36.22 143.99 18 6 PHE A 46 ? ? -138.12 -59.64 19 6 ASP A 132 ? ? -157.17 -49.26 20 6 LEU A 133 ? ? -90.18 32.60 21 6 PRO A 136 ? ? -78.09 46.09 22 6 PRO A 138 ? ? -34.26 147.20 23 7 PHE A 46 ? ? -136.89 -52.59 24 7 PRO A 51 ? ? -80.43 43.74 25 7 ASP A 132 ? ? -161.73 -45.61 26 7 PRO A 136 ? ? -78.04 45.62 27 8 LEU A 31 ? ? -67.09 99.54 28 8 PHE A 46 ? ? -136.98 -53.98 29 8 PRO A 51 ? ? -80.17 46.27 30 8 ASP A 132 ? ? -163.48 -39.73 31 8 PRO A 136 ? ? -64.97 63.17 32 9 PHE A 46 ? ? -136.39 -55.86 33 9 ASP A 132 ? ? -159.54 -52.10 34 10 PHE A 46 ? ? -137.96 -59.21 35 10 ASP A 131 ? ? -91.28 -65.41 36 10 ASP A 132 ? ? -157.15 -43.15 37 11 LEU A 31 ? ? -66.01 97.84 38 11 PHE A 46 ? ? -136.29 -52.70 39 11 ASP A 132 ? ? -163.65 -45.91 40 11 PRO A 136 ? ? -63.74 60.41 41 12 LEU A 31 ? ? -64.21 97.21 42 12 PHE A 46 ? ? -137.40 -56.13 43 12 PRO A 51 ? ? -80.46 47.90 44 12 ASP A 132 ? ? -159.08 -47.94 45 12 LEU A 133 ? ? -90.66 33.44 46 12 PRO A 136 ? ? -78.35 46.25 47 13 PHE A 46 ? ? -136.79 -55.32 48 13 PRO A 51 ? ? -80.65 48.85 49 13 ASP A 132 ? ? -165.05 -45.54 50 14 PHE A 46 ? ? -136.38 -56.43 51 14 GLU A 58 ? ? -62.33 11.04 52 14 GLN A 109 ? ? -71.74 31.57 53 14 ASP A 132 ? ? -159.80 -39.54 54 14 PRO A 136 ? ? -77.19 48.47 55 15 LEU A 31 ? ? -63.56 97.98 56 15 PHE A 46 ? ? -136.84 -53.19 57 15 ASP A 131 ? ? -85.26 -70.22 58 15 ASP A 132 ? ? -160.56 -41.10 59 16 LEU A 31 ? ? -67.10 94.37 60 16 PHE A 46 ? ? -135.26 -54.49 61 16 GLU A 58 ? ? -62.39 8.31 62 16 ASP A 132 ? ? -161.22 -43.70 63 17 ASP A 29 ? ? -64.48 1.34 64 17 PHE A 46 ? ? -135.14 -56.58 65 17 ASP A 132 ? ? -158.30 -48.45 66 17 PRO A 136 ? ? -78.59 45.21 67 18 LEU A 31 ? ? -66.34 97.78 68 18 PHE A 46 ? ? -136.96 -54.08 69 18 ASP A 132 ? ? -163.48 -41.22 70 18 PRO A 138 ? ? -36.82 147.01 71 19 PHE A 46 ? ? -136.99 -55.10 72 19 GLN A 109 ? ? -66.61 21.13 73 19 ASP A 132 ? ? -161.68 -41.87 74 20 LEU A 31 ? ? -65.94 97.54 75 20 PHE A 46 ? ? -136.15 -56.97 76 20 ASP A 132 ? ? -160.82 -46.86 77 20 PRO A 136 ? ? -78.41 47.15 78 20 PRO A 138 ? ? -37.49 146.98 79 21 PHE A 46 ? ? -135.45 -55.37 80 21 ASP A 132 ? ? -157.24 -43.35 81 21 PRO A 136 ? ? -78.63 47.70 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLY _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 146 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ALA _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 147 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 125.99 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id GLY _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 146 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle 21.03 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 HIS A 10 ? ? 0.090 'SIDE CHAIN' 2 1 TYR A 35 ? ? 0.125 'SIDE CHAIN' 3 1 TYR A 144 ? ? 0.178 'SIDE CHAIN' 4 10 ARG A 22 ? ? 0.075 'SIDE CHAIN' #