data_2KCX # _entry.id 2KCX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KCX pdb_00002kcx 10.2210/pdb2kcx/pdb RCSB RCSB100964 ? ? WWPDB D_1000100964 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id HR6186A _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KCX _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-12-30 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rossi, P.' 1 'Chiang, Y.' 2 'Anderson, S.' 3 'Montelione, G.T.' 4 'Northeast Structural Genomics Consortium (NESG)' 5 # _citation.id primary _citation.title ;Solution NMR Structure of Kazal-1 Domain of Human Follistatin-related protein 3 (FSTL-3). Northeast Structural Genomics Target HR6186A. ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rossi, P.' 1 ? primary 'Chiang, Y.' 2 ? primary 'Anderson, S.' 3 ? primary 'Montelione, G.T.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Follistatin-related protein 3' _entity.formula_weight 7981.164 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Kazal-1 domain, residues 97-169' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Follistatin-like 3, Follistatin-related gene protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRK _entity_poly.pdbx_seq_one_letter_code_can SDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier HR6186A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASP n 1 3 SER n 1 4 CYS n 1 5 ASP n 1 6 GLY n 1 7 VAL n 1 8 GLU n 1 9 CYS n 1 10 GLY n 1 11 PRO n 1 12 GLY n 1 13 LYS n 1 14 ALA n 1 15 CYS n 1 16 ARG n 1 17 MET n 1 18 LEU n 1 19 GLY n 1 20 GLY n 1 21 ARG n 1 22 PRO n 1 23 ARG n 1 24 CYS n 1 25 GLU n 1 26 CYS n 1 27 ALA n 1 28 PRO n 1 29 ASP n 1 30 CYS n 1 31 SER n 1 32 GLY n 1 33 LEU n 1 34 PRO n 1 35 ALA n 1 36 ARG n 1 37 LEU n 1 38 GLN n 1 39 VAL n 1 40 CYS n 1 41 GLY n 1 42 SER n 1 43 ASP n 1 44 GLY n 1 45 ALA n 1 46 THR n 1 47 TYR n 1 48 ARG n 1 49 ASP n 1 50 GLU n 1 51 CYS n 1 52 GLU n 1 53 LEU n 1 54 ARG n 1 55 ALA n 1 56 ALA n 1 57 ARG n 1 58 CYS n 1 59 ARG n 1 60 GLY n 1 61 HIS n 1 62 PRO n 1 63 ASP n 1 64 LEU n 1 65 SER n 1 66 VAL n 1 67 MET n 1 68 TYR n 1 69 ARG n 1 70 GLY n 1 71 ARG n 1 72 CYS n 1 73 ARG n 1 74 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FSTL3, FLRG, UNQ674/PRO1308' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FSTL3_HUMAN _struct_ref.pdbx_db_accession O95633 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRK _struct_ref.pdbx_align_begin 97 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KCX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 74 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O95633 _struct_ref_seq.db_align_beg 97 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 169 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 74 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2KCX _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O95633 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D 1H-15N NOESY' 1 5 1 '3D 1H-13C NOESY' 1 6 1 '3D HNCACB' 1 7 1 '3D HNCO' 1 8 1 '3D HBHA(CO)NH' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D HCCH-COSY' 1 11 1 '3D CCH-TOCSY' 1 12 1 '3D HNCA' 1 13 2 '2D 1H-15N HET_NOE' 1 14 2 '2D N15 T1' 1 15 2 '2D N15 T2 cpmg' 1 16 2 '2D 1H-15N HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.2 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.6 mM [U-100% 13C; U-100% 15N] FSTL-3-1, 20 mM MES-2, 200 mM sodium chloride-3, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.2 mM [U-100% 15N] FSTL-3-4, 20 mM MES-5, 200 mM sodium chloride-6, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KCX _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;MONOMER BY GEL FILTRATION CHROMATOGRAPHY/LIGHT SCATTERING AND BY NMR. T1/T2(CPMG) (MS) = 516.1/136.2, TAUC = 3.94(NS). CONSISTENT WITH MOLECULAR WEIGHT. STRUCTURE DETERMINED BY TRIPLE RESONANCE NMR SPECTROSCOPY. NOESY ASSIGNMENTS BY CYANA2.1. 20 OF 100 STRUCTURES LOWEST TARGET FUNCTION SELECTED WITH CYANA-2.1. SELECTED MODELS ARE FURTHER REFINED USING CNS IN EXPLICIT WATER SHELL (NILGES PROTOCOL WITH PARAM19). ASSIGNMENT STATS (EXCLUDING C-TERM TAG): BACKBONE 98.10%, SIDECHAIN 88.50%, AROMATIC (SC) 75.00%. STRUCTURE BASED ON 912 NOE, 65 DIHE. MAX NOE VIOLATION: 0.19 A (1MODEL); MAX DIHE VIOLATION: 5.4 DEG. 6 TOTAL CLOSE CONTACTS PER 20 MODELS. STRUCTURE QUALITY FACTOR (PSVS 1.3): ORDERED RESIDUES RANGES: 4-9, 13-27, 33-34, 37-58, 61-69, 72-73 FOR [S(PHI)+S(PSI)] > 1.8. SECONDARY STRUCTURE - ALPHA HELICES: 50-60, BETA STRANDS: 13-18, 21-26, 46-47, 39-41, 66-69. RMSD 1.3 BACKBONE, 1.8 ALL HEAVY ATOMS. RAMA. DISTRIBUTION: 92.1/7.8/0.1/0.0. PROCHECK (PSI-PHI): -0.34/-1.02 (RAW/Z), PROCHECK (ALL): -0.33/-1.95 (RAW/Z), MOLPROBITY CLASH: 19.69/-1.85 (RAW/Z). RPF SCORES ALL ASSIGNED RESIDUES (FIT OF NOESY PEAKLISTS TO STRUCTURE): RECALL: 0.99, PRECISION: 0.85, F-MEASURE: 0.91, DP-SCORE: 0.82. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KCX _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KCX _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS ? 2 'Bhattacharya and Montelione' 'structure solution' PSVS 1.3 3 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2008 5 Goddard 'data analysis' Sparky 2.113 6 'Bruker Biospin' collection TopSpin 2.1 7 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE ? 8 'Koradi, Billeter and Wuthrich' visualization MOLMOL ? 9 'Laskowski, MacArthur, Smith, Jones, Hutchinson, Morris, Moss and Tho' refinement Procheck ? 10 Richardson refinement MolProbity ? 11 'Tejero, Montelione' 'data analysis' PdbStat ? 12 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KCX _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KCX _struct.title ;Solution NMR Structure of Kazal-1 Domain of Human Follistatin-related protein 3 (FSTL-3). Northeast Structural Genomics Target HR6186A. ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KCX _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text ;Kazal-1, Follistatin, Chromosomal rearrangement, Glycoprotein, Nucleus, Proto-oncogene, Secreted, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, unknown function, NUCLEOTIDE-BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 49 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 59 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 49 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 59 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 15 SG ? ? A CYS 4 A CYS 15 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 24 SG ? ? A CYS 9 A CYS 24 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf3 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 58 SG ? ? A CYS 26 A CYS 58 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf4 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 30 A CYS 51 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf5 disulf ? ? A CYS 40 SG ? ? ? 1_555 A CYS 72 SG ? ? A CYS 40 A CYS 72 1_555 ? ? ? ? ? ? ? 2.032 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 14 ? LEU A 18 ? ALA A 14 LEU A 18 A 2 ARG A 21 ? GLU A 25 ? ARG A 21 GLU A 25 B 1 THR A 46 ? TYR A 47 ? THR A 46 TYR A 47 B 2 VAL A 39 ? GLY A 41 ? VAL A 39 GLY A 41 B 3 VAL A 66 ? ARG A 69 ? VAL A 66 ARG A 69 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 18 ? N LEU A 18 O ARG A 21 ? O ARG A 21 B 1 2 O TYR A 47 ? O TYR A 47 N VAL A 39 ? N VAL A 39 B 2 3 N CYS A 40 ? N CYS A 40 O TYR A 68 ? O TYR A 68 # _atom_sites.entry_id 2KCX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 MET 67 67 67 MET MET A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 LYS 74 74 74 LYS LYS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-03-10 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id FSTL-3-1 0.6 ? mM '[U-100% 13C; U-100% 15N]' 1 MES-2 20 ? mM ? 1 'sodium chloride-3' 200 ? mM ? 1 FSTL-3-4 0.2 ? mM '[U-100% 15N]' 2 MES-5 20 ? mM ? 2 'sodium chloride-6' 200 ? mM ? 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 11 ? ? -60.67 88.59 2 1 PRO A 28 ? ? -59.71 107.75 3 1 SER A 31 ? ? -78.76 -145.83 4 1 ARG A 59 ? ? -78.04 34.85 5 2 PRO A 11 ? ? -50.39 107.84 6 2 ASP A 29 ? ? -76.41 31.70 7 2 SER A 31 ? ? -69.17 75.88 8 2 ARG A 59 ? ? -106.35 51.69 9 3 ASP A 2 ? ? -60.26 97.50 10 3 CYS A 26 ? ? -54.26 108.55 11 3 ASP A 29 ? ? -67.86 82.50 12 3 SER A 31 ? ? -145.65 -53.90 13 3 ALA A 35 ? ? -82.29 38.80 14 3 CYS A 72 ? ? -61.90 94.86 15 4 PRO A 11 ? ? -67.51 90.35 16 4 ASP A 29 ? ? -78.35 41.49 17 4 CYS A 72 ? ? -48.28 99.59 18 5 PRO A 11 ? ? -65.14 90.53 19 5 CYS A 26 ? ? -56.86 97.88 20 5 ASP A 29 ? ? -75.66 36.22 21 5 ARG A 36 ? ? 69.33 -15.20 22 6 CYS A 26 ? ? -62.82 99.83 23 6 ASP A 29 ? ? -65.36 94.22 24 6 CYS A 72 ? ? 34.84 91.80 25 7 CYS A 26 ? ? -58.60 105.04 26 7 CYS A 30 ? ? 73.40 -39.91 27 7 CYS A 72 ? ? -67.01 98.16 28 8 PRO A 11 ? ? -61.23 92.13 29 8 PRO A 28 ? ? -79.59 24.45 30 8 CYS A 72 ? ? -66.08 83.78 31 9 CYS A 26 ? ? -52.18 106.74 32 9 ASP A 29 ? ? 63.36 96.86 33 9 ARG A 36 ? ? 177.51 15.21 34 9 ARG A 59 ? ? -97.17 49.51 35 10 SER A 31 ? ? -77.01 -76.44 36 11 CYS A 30 ? ? -65.52 78.62 37 11 CYS A 72 ? ? -53.85 102.49 38 12 PRO A 11 ? ? -61.67 92.76 39 12 PRO A 22 ? ? -66.75 93.80 40 12 CYS A 26 ? ? -68.42 97.82 41 12 CYS A 30 ? ? -169.60 40.97 42 12 CYS A 72 ? ? -60.89 97.96 43 13 SER A 31 ? ? -138.43 -83.01 44 13 ARG A 36 ? ? -143.87 -13.38 45 13 ARG A 59 ? ? -84.99 30.31 46 13 CYS A 72 ? ? -55.17 84.63 47 14 SER A 3 ? ? -123.76 -166.41 48 14 PRO A 11 ? ? -78.36 42.83 49 14 CYS A 26 ? ? -58.72 95.86 50 14 PRO A 28 ? ? -82.68 -158.87 51 14 ARG A 71 ? ? 61.47 172.08 52 15 PRO A 11 ? ? -61.66 93.64 53 15 CYS A 26 ? ? -54.05 95.32 54 15 PRO A 28 ? ? -68.45 90.84 55 15 ASP A 29 ? ? -67.77 -70.50 56 15 CYS A 30 ? ? 55.55 72.79 57 15 ARG A 36 ? ? -151.24 -35.57 58 15 CYS A 72 ? ? -66.42 93.68 59 16 ASP A 29 ? ? -66.04 84.89 60 16 SER A 31 ? ? -69.12 83.20 61 17 CYS A 26 ? ? -37.65 124.93 62 17 ASP A 29 ? ? -51.75 101.45 63 17 CYS A 72 ? ? -68.49 96.99 64 18 CYS A 26 ? ? -64.22 95.87 65 18 PRO A 28 ? ? -59.86 102.15 66 18 ARG A 71 ? ? 45.61 -177.54 67 19 PRO A 11 ? ? -67.03 79.46 68 19 SER A 31 ? ? -99.49 -76.01 69 19 CYS A 72 ? ? -59.79 95.01 70 20 ASP A 2 ? ? -69.34 80.73 71 20 PRO A 11 ? ? -69.63 87.09 72 20 CYS A 26 ? ? -64.17 84.04 73 20 ASP A 29 ? ? -63.21 98.98 74 20 CYS A 72 ? ? -58.12 99.88 #