data_2KDL # _entry.id 2KDL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KDL pdb_00002kdl 10.2210/pdb2kdl/pdb RCSB RCSB100988 ? ? WWPDB D_1000100988 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-12-29 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KDL _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-01-12 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, Y.' 1 'Alexander, P.' 2 'Chen, Y.' 3 'Bryan, P.' 4 'Orban, J.' 5 # _citation.id primary _citation.title 'A minimal sequence code for switching protein structure and function.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 106 _citation.page_first 21149 _citation.page_last 21154 _citation.year 2009 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19923431 _citation.pdbx_database_id_DOI 10.1073/pnas.0906408106 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Alexander, P.A.' 1 ? primary 'He, Y.' 2 ? primary 'Chen, Y.' 3 ? primary 'Orban, J.' 4 ? primary 'Bryan, P.N.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'designed protein' _entity.formula_weight 6321.330 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code TTYKLILNLKQAKEEAIKELVDAGTAEKYIKLIANAKTVEGVWTLKDEIKTFTVTE _entity_poly.pdbx_seq_one_letter_code_can TTYKLILNLKQAKEEAIKELVDAGTAEKYIKLIANAKTVEGVWTLKDEIKTFTVTE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 THR n 1 3 TYR n 1 4 LYS n 1 5 LEU n 1 6 ILE n 1 7 LEU n 1 8 ASN n 1 9 LEU n 1 10 LYS n 1 11 GLN n 1 12 ALA n 1 13 LYS n 1 14 GLU n 1 15 GLU n 1 16 ALA n 1 17 ILE n 1 18 LYS n 1 19 GLU n 1 20 LEU n 1 21 VAL n 1 22 ASP n 1 23 ALA n 1 24 GLY n 1 25 THR n 1 26 ALA n 1 27 GLU n 1 28 LYS n 1 29 TYR n 1 30 ILE n 1 31 LYS n 1 32 LEU n 1 33 ILE n 1 34 ALA n 1 35 ASN n 1 36 ALA n 1 37 LYS n 1 38 THR n 1 39 VAL n 1 40 GLU n 1 41 GLY n 1 42 VAL n 1 43 TRP n 1 44 THR n 1 45 LEU n 1 46 LYS n 1 47 ASP n 1 48 GLU n 1 49 ILE n 1 50 LYS n 1 51 THR n 1 52 PHE n 1 53 THR n 1 54 VAL n 1 55 THR n 1 56 GLU n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'designed protein' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLU 56 56 56 GLU GLU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KDL _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KDL _struct.title 'NMR structures of GA95 and GB95, two designed proteins with 95% sequence identity but different folds and functions' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KDL _struct_keywords.pdbx_keywords 'Human serum albumin binding protein' _struct_keywords.text 'evolution, folding, protein design, Human serum albumin binding protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2KDL _struct_ref.pdbx_db_accession 2KDL _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TTYKLILNLKQAKEEAIKELVDAGTAEKYIKLIANAKTVEGVWTLKDEIKTFTVTE _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KDL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 56 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2KDL _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 56 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 56 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 8 ? GLY A 24 ? ASN A 8 GLY A 24 1 ? 17 HELX_P HELX_P2 2 ALA A 26 ? ALA A 34 ? ALA A 26 ALA A 34 1 ? 9 HELX_P HELX_P3 3 THR A 38 ? PHE A 52 ? THR A 38 PHE A 52 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 8 O A LEU 9 ? ? H A LYS 13 ? ? 1.60 2 10 O A LEU 9 ? ? H A LYS 13 ? ? 1.58 3 11 O A LEU 9 ? ? H A LYS 13 ? ? 1.59 4 14 O A LEU 9 ? ? H A LYS 13 ? ? 1.60 5 16 O A LEU 9 ? ? H A LYS 13 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 2 ? ? -144.88 -46.73 2 1 LEU A 5 ? ? -178.96 113.53 3 1 ASN A 8 ? ? 176.51 123.54 4 1 ALA A 23 ? ? -98.56 -60.33 5 1 ALA A 26 ? ? -55.34 99.34 6 1 THR A 53 ? ? 51.86 -169.95 7 1 THR A 55 ? ? 61.70 82.55 8 2 LEU A 7 ? ? -73.93 -79.29 9 2 ASN A 8 ? ? -166.69 99.90 10 2 ALA A 23 ? ? -129.66 -71.35 11 2 THR A 25 ? ? 46.93 179.18 12 2 ALA A 36 ? ? -35.80 -37.21 13 2 LYS A 37 ? ? 66.19 -66.37 14 2 VAL A 54 ? ? -175.80 137.69 15 2 THR A 55 ? ? -59.90 171.54 16 3 LEU A 5 ? ? 58.89 172.44 17 3 LEU A 7 ? ? -158.29 -41.85 18 3 ALA A 23 ? ? -131.74 -77.22 19 3 THR A 25 ? ? 46.92 179.26 20 3 ALA A 26 ? ? -66.97 97.36 21 4 LEU A 5 ? ? -174.62 117.37 22 4 ALA A 23 ? ? -126.87 -76.08 23 4 THR A 25 ? ? 42.00 -165.31 24 5 THR A 2 ? ? 52.76 -85.77 25 5 TYR A 3 ? ? -162.09 -50.99 26 5 LEU A 5 ? ? -176.52 93.94 27 5 ASN A 8 ? ? -159.73 29.48 28 5 THR A 25 ? ? -170.85 -166.88 29 5 ALA A 26 ? ? -64.74 88.23 30 5 ALA A 36 ? ? 37.66 -93.02 31 5 LYS A 37 ? ? 163.67 -33.72 32 6 THR A 2 ? ? -97.67 31.37 33 6 LYS A 4 ? ? -104.60 -168.30 34 6 LEU A 5 ? ? -177.74 59.20 35 6 LEU A 7 ? ? 47.44 -92.62 36 6 ASN A 8 ? ? -174.26 -50.07 37 6 ALA A 23 ? ? -131.00 -81.37 38 6 THR A 25 ? ? 42.49 -167.48 39 6 ALA A 36 ? ? -35.71 -36.87 40 6 LYS A 37 ? ? 69.28 -66.35 41 6 THR A 53 ? ? 60.07 158.04 42 6 VAL A 54 ? ? -135.65 -46.65 43 6 THR A 55 ? ? -140.80 31.46 44 7 LYS A 4 ? ? -65.90 -167.17 45 7 LEU A 5 ? ? -165.95 -69.24 46 7 LEU A 7 ? ? -136.64 -72.26 47 7 ASN A 8 ? ? -177.62 115.89 48 7 ALA A 23 ? ? -105.75 -71.60 49 7 ALA A 26 ? ? -56.59 95.89 50 7 LYS A 37 ? ? 65.47 -73.83 51 7 PHE A 52 ? ? -164.72 -155.34 52 7 THR A 53 ? ? -151.72 -75.78 53 8 LYS A 4 ? ? -105.82 -167.57 54 8 LEU A 5 ? ? -174.01 112.10 55 8 LEU A 7 ? ? -122.60 -58.14 56 8 ASN A 8 ? ? 179.82 -33.09 57 8 ALA A 23 ? ? -135.16 -86.40 58 8 THR A 25 ? ? 42.41 -166.08 59 9 THR A 2 ? ? 63.10 125.66 60 9 LEU A 5 ? ? 179.71 88.19 61 9 LEU A 7 ? ? 55.95 -85.04 62 9 ASN A 8 ? ? -166.97 115.54 63 9 ALA A 26 ? ? -60.01 88.98 64 9 THR A 53 ? ? -51.59 -75.88 65 10 LYS A 4 ? ? 53.02 -174.85 66 10 LEU A 5 ? ? -177.49 90.24 67 10 LEU A 7 ? ? -65.15 -72.63 68 10 ASN A 8 ? ? -145.78 55.22 69 10 ALA A 23 ? ? -132.41 -80.48 70 10 THR A 25 ? ? 42.48 -165.19 71 11 THR A 2 ? ? -58.67 -178.42 72 11 ASN A 8 ? ? -160.24 29.38 73 11 ALA A 26 ? ? -54.88 100.96 74 11 ALA A 36 ? ? -33.82 -37.32 75 11 LYS A 37 ? ? 69.54 -65.98 76 12 THR A 2 ? ? -110.21 -82.60 77 12 LEU A 5 ? ? -177.01 73.79 78 12 LEU A 7 ? ? -94.89 -82.11 79 12 ASN A 8 ? ? -134.54 -37.05 80 12 ALA A 26 ? ? -46.88 95.03 81 12 THR A 55 ? ? -141.40 31.82 82 13 ILE A 6 ? ? -56.34 90.26 83 13 LEU A 7 ? ? -74.32 -78.91 84 13 ASN A 8 ? ? -147.95 31.35 85 13 THR A 25 ? ? 41.91 -166.74 86 13 ALA A 36 ? ? -38.52 -33.15 87 13 LYS A 37 ? ? 66.82 -71.96 88 13 VAL A 54 ? ? 59.13 89.29 89 14 TYR A 3 ? ? -173.92 -41.34 90 14 LEU A 5 ? ? 59.86 -83.24 91 14 ASN A 8 ? ? -149.52 29.81 92 14 ALA A 23 ? ? -134.89 -77.81 93 14 THR A 25 ? ? 41.69 -166.11 94 14 ALA A 36 ? ? 39.73 -112.89 95 14 LYS A 37 ? ? 179.35 -40.23 96 15 LEU A 5 ? ? 59.76 96.41 97 15 LEU A 7 ? ? -59.17 -74.64 98 15 ASN A 8 ? ? -174.70 89.90 99 15 ALA A 23 ? ? -109.76 -75.61 100 15 THR A 25 ? ? -162.95 -167.44 101 15 ALA A 26 ? ? -58.13 84.70 102 15 PHE A 52 ? ? -159.15 -156.88 103 15 THR A 53 ? ? -179.62 69.11 104 15 THR A 55 ? ? 62.71 88.22 105 16 THR A 2 ? ? -105.31 50.79 106 16 LEU A 7 ? ? -74.51 -76.50 107 16 ALA A 23 ? ? -130.40 -82.34 108 16 THR A 25 ? ? 40.08 -163.73 109 16 ALA A 36 ? ? 38.67 -94.57 110 16 LYS A 37 ? ? 164.44 -33.83 111 16 THR A 53 ? ? 51.02 172.97 112 16 THR A 55 ? ? -140.96 -47.75 113 17 LEU A 7 ? ? -106.69 -65.81 114 17 ASN A 8 ? ? -179.20 -34.36 115 17 ALA A 23 ? ? -100.68 -70.70 116 17 ALA A 26 ? ? -56.44 87.35 117 17 ALA A 36 ? ? -35.87 -35.40 118 17 LYS A 37 ? ? 66.68 -66.26 119 17 THR A 53 ? ? -118.67 -159.81 120 17 VAL A 54 ? ? 46.54 113.78 121 17 THR A 55 ? ? 70.44 153.96 122 18 THR A 2 ? ? 43.01 92.26 123 18 LYS A 4 ? ? -112.88 -169.47 124 18 LEU A 5 ? ? -172.54 117.37 125 18 ASN A 8 ? ? -179.94 -35.00 126 18 ALA A 23 ? ? -132.41 -83.28 127 18 THR A 25 ? ? 42.75 -174.37 128 18 ALA A 26 ? ? -67.46 97.63 129 18 LYS A 37 ? ? 68.51 -70.49 130 18 THR A 53 ? ? -145.00 -82.92 131 19 LEU A 5 ? ? 68.85 -67.66 132 19 ILE A 6 ? ? -58.64 88.05 133 19 ASN A 8 ? ? 85.42 -16.64 134 19 ALA A 23 ? ? -129.89 -83.86 135 19 THR A 25 ? ? 40.33 -163.60 136 19 ALA A 36 ? ? -37.63 -33.37 137 19 LYS A 37 ? ? 67.04 -70.06 138 19 THR A 53 ? ? 57.75 87.54 139 19 THR A 55 ? ? -141.46 43.53 140 20 LEU A 5 ? ? 61.76 -167.69 141 20 ILE A 6 ? ? -63.24 94.61 142 20 ALA A 23 ? ? -108.77 -79.24 143 20 ALA A 26 ? ? -44.62 99.02 144 20 ALA A 36 ? ? 40.29 -113.86 145 20 LYS A 37 ? ? 178.26 -39.59 146 20 THR A 55 ? ? -64.35 80.29 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KDL _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KDL _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.contents '0.15~0.3 mM mM [U-100% 13C; U-100% 15N] Ga95, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component Ga95 _pdbx_nmr_exptl_sample.concentration ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.concentration_range 0.15-0.3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCACB' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HBHA(CO)NH' 1 5 1 '3D H(CCO)NH' 1 6 1 '3D C(CO)NH' 1 7 1 '3D HNCO' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY aliphatic' 1 10 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_refine.entry_id 2KDL _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.2 1 'Bruker Biospin' collection XwinNMR 2.5 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe . 3 Goddard 'data analysis' Sparky 3 4 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 ILE N N N N 96 ILE CA C N S 97 ILE C C N N 98 ILE O O N N 99 ILE CB C N S 100 ILE CG1 C N N 101 ILE CG2 C N N 102 ILE CD1 C N N 103 ILE OXT O N N 104 ILE H H N N 105 ILE H2 H N N 106 ILE HA H N N 107 ILE HB H N N 108 ILE HG12 H N N 109 ILE HG13 H N N 110 ILE HG21 H N N 111 ILE HG22 H N N 112 ILE HG23 H N N 113 ILE HD11 H N N 114 ILE HD12 H N N 115 ILE HD13 H N N 116 ILE HXT H N N 117 LEU N N N N 118 LEU CA C N S 119 LEU C C N N 120 LEU O O N N 121 LEU CB C N N 122 LEU CG C N N 123 LEU CD1 C N N 124 LEU CD2 C N N 125 LEU OXT O N N 126 LEU H H N N 127 LEU H2 H N N 128 LEU HA H N N 129 LEU HB2 H N N 130 LEU HB3 H N N 131 LEU HG H N N 132 LEU HD11 H N N 133 LEU HD12 H N N 134 LEU HD13 H N N 135 LEU HD21 H N N 136 LEU HD22 H N N 137 LEU HD23 H N N 138 LEU HXT H N N 139 LYS N N N N 140 LYS CA C N S 141 LYS C C N N 142 LYS O O N N 143 LYS CB C N N 144 LYS CG C N N 145 LYS CD C N N 146 LYS CE C N N 147 LYS NZ N N N 148 LYS OXT O N N 149 LYS H H N N 150 LYS H2 H N N 151 LYS HA H N N 152 LYS HB2 H N N 153 LYS HB3 H N N 154 LYS HG2 H N N 155 LYS HG3 H N N 156 LYS HD2 H N N 157 LYS HD3 H N N 158 LYS HE2 H N N 159 LYS HE3 H N N 160 LYS HZ1 H N N 161 LYS HZ2 H N N 162 LYS HZ3 H N N 163 LYS HXT H N N 164 PHE N N N N 165 PHE CA C N S 166 PHE C C N N 167 PHE O O N N 168 PHE CB C N N 169 PHE CG C Y N 170 PHE CD1 C Y N 171 PHE CD2 C Y N 172 PHE CE1 C Y N 173 PHE CE2 C Y N 174 PHE CZ C Y N 175 PHE OXT O N N 176 PHE H H N N 177 PHE H2 H N N 178 PHE HA H N N 179 PHE HB2 H N N 180 PHE HB3 H N N 181 PHE HD1 H N N 182 PHE HD2 H N N 183 PHE HE1 H N N 184 PHE HE2 H N N 185 PHE HZ H N N 186 PHE HXT H N N 187 THR N N N N 188 THR CA C N S 189 THR C C N N 190 THR O O N N 191 THR CB C N R 192 THR OG1 O N N 193 THR CG2 C N N 194 THR OXT O N N 195 THR H H N N 196 THR H2 H N N 197 THR HA H N N 198 THR HB H N N 199 THR HG1 H N N 200 THR HG21 H N N 201 THR HG22 H N N 202 THR HG23 H N N 203 THR HXT H N N 204 TRP N N N N 205 TRP CA C N S 206 TRP C C N N 207 TRP O O N N 208 TRP CB C N N 209 TRP CG C Y N 210 TRP CD1 C Y N 211 TRP CD2 C Y N 212 TRP NE1 N Y N 213 TRP CE2 C Y N 214 TRP CE3 C Y N 215 TRP CZ2 C Y N 216 TRP CZ3 C Y N 217 TRP CH2 C Y N 218 TRP OXT O N N 219 TRP H H N N 220 TRP H2 H N N 221 TRP HA H N N 222 TRP HB2 H N N 223 TRP HB3 H N N 224 TRP HD1 H N N 225 TRP HE1 H N N 226 TRP HE3 H N N 227 TRP HZ2 H N N 228 TRP HZ3 H N N 229 TRP HH2 H N N 230 TRP HXT H N N 231 TYR N N N N 232 TYR CA C N S 233 TYR C C N N 234 TYR O O N N 235 TYR CB C N N 236 TYR CG C Y N 237 TYR CD1 C Y N 238 TYR CD2 C Y N 239 TYR CE1 C Y N 240 TYR CE2 C Y N 241 TYR CZ C Y N 242 TYR OH O N N 243 TYR OXT O N N 244 TYR H H N N 245 TYR H2 H N N 246 TYR HA H N N 247 TYR HB2 H N N 248 TYR HB3 H N N 249 TYR HD1 H N N 250 TYR HD2 H N N 251 TYR HE1 H N N 252 TYR HE2 H N N 253 TYR HH H N N 254 TYR HXT H N N 255 VAL N N N N 256 VAL CA C N S 257 VAL C C N N 258 VAL O O N N 259 VAL CB C N N 260 VAL CG1 C N N 261 VAL CG2 C N N 262 VAL OXT O N N 263 VAL H H N N 264 VAL H2 H N N 265 VAL HA H N N 266 VAL HB H N N 267 VAL HG11 H N N 268 VAL HG12 H N N 269 VAL HG13 H N N 270 VAL HG21 H N N 271 VAL HG22 H N N 272 VAL HG23 H N N 273 VAL HXT H N N 274 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 ILE N CA sing N N 90 ILE N H sing N N 91 ILE N H2 sing N N 92 ILE CA C sing N N 93 ILE CA CB sing N N 94 ILE CA HA sing N N 95 ILE C O doub N N 96 ILE C OXT sing N N 97 ILE CB CG1 sing N N 98 ILE CB CG2 sing N N 99 ILE CB HB sing N N 100 ILE CG1 CD1 sing N N 101 ILE CG1 HG12 sing N N 102 ILE CG1 HG13 sing N N 103 ILE CG2 HG21 sing N N 104 ILE CG2 HG22 sing N N 105 ILE CG2 HG23 sing N N 106 ILE CD1 HD11 sing N N 107 ILE CD1 HD12 sing N N 108 ILE CD1 HD13 sing N N 109 ILE OXT HXT sing N N 110 LEU N CA sing N N 111 LEU N H sing N N 112 LEU N H2 sing N N 113 LEU CA C sing N N 114 LEU CA CB sing N N 115 LEU CA HA sing N N 116 LEU C O doub N N 117 LEU C OXT sing N N 118 LEU CB CG sing N N 119 LEU CB HB2 sing N N 120 LEU CB HB3 sing N N 121 LEU CG CD1 sing N N 122 LEU CG CD2 sing N N 123 LEU CG HG sing N N 124 LEU CD1 HD11 sing N N 125 LEU CD1 HD12 sing N N 126 LEU CD1 HD13 sing N N 127 LEU CD2 HD21 sing N N 128 LEU CD2 HD22 sing N N 129 LEU CD2 HD23 sing N N 130 LEU OXT HXT sing N N 131 LYS N CA sing N N 132 LYS N H sing N N 133 LYS N H2 sing N N 134 LYS CA C sing N N 135 LYS CA CB sing N N 136 LYS CA HA sing N N 137 LYS C O doub N N 138 LYS C OXT sing N N 139 LYS CB CG sing N N 140 LYS CB HB2 sing N N 141 LYS CB HB3 sing N N 142 LYS CG CD sing N N 143 LYS CG HG2 sing N N 144 LYS CG HG3 sing N N 145 LYS CD CE sing N N 146 LYS CD HD2 sing N N 147 LYS CD HD3 sing N N 148 LYS CE NZ sing N N 149 LYS CE HE2 sing N N 150 LYS CE HE3 sing N N 151 LYS NZ HZ1 sing N N 152 LYS NZ HZ2 sing N N 153 LYS NZ HZ3 sing N N 154 LYS OXT HXT sing N N 155 PHE N CA sing N N 156 PHE N H sing N N 157 PHE N H2 sing N N 158 PHE CA C sing N N 159 PHE CA CB sing N N 160 PHE CA HA sing N N 161 PHE C O doub N N 162 PHE C OXT sing N N 163 PHE CB CG sing N N 164 PHE CB HB2 sing N N 165 PHE CB HB3 sing N N 166 PHE CG CD1 doub Y N 167 PHE CG CD2 sing Y N 168 PHE CD1 CE1 sing Y N 169 PHE CD1 HD1 sing N N 170 PHE CD2 CE2 doub Y N 171 PHE CD2 HD2 sing N N 172 PHE CE1 CZ doub Y N 173 PHE CE1 HE1 sing N N 174 PHE CE2 CZ sing Y N 175 PHE CE2 HE2 sing N N 176 PHE CZ HZ sing N N 177 PHE OXT HXT sing N N 178 THR N CA sing N N 179 THR N H sing N N 180 THR N H2 sing N N 181 THR CA C sing N N 182 THR CA CB sing N N 183 THR CA HA sing N N 184 THR C O doub N N 185 THR C OXT sing N N 186 THR CB OG1 sing N N 187 THR CB CG2 sing N N 188 THR CB HB sing N N 189 THR OG1 HG1 sing N N 190 THR CG2 HG21 sing N N 191 THR CG2 HG22 sing N N 192 THR CG2 HG23 sing N N 193 THR OXT HXT sing N N 194 TRP N CA sing N N 195 TRP N H sing N N 196 TRP N H2 sing N N 197 TRP CA C sing N N 198 TRP CA CB sing N N 199 TRP CA HA sing N N 200 TRP C O doub N N 201 TRP C OXT sing N N 202 TRP CB CG sing N N 203 TRP CB HB2 sing N N 204 TRP CB HB3 sing N N 205 TRP CG CD1 doub Y N 206 TRP CG CD2 sing Y N 207 TRP CD1 NE1 sing Y N 208 TRP CD1 HD1 sing N N 209 TRP CD2 CE2 doub Y N 210 TRP CD2 CE3 sing Y N 211 TRP NE1 CE2 sing Y N 212 TRP NE1 HE1 sing N N 213 TRP CE2 CZ2 sing Y N 214 TRP CE3 CZ3 doub Y N 215 TRP CE3 HE3 sing N N 216 TRP CZ2 CH2 doub Y N 217 TRP CZ2 HZ2 sing N N 218 TRP CZ3 CH2 sing Y N 219 TRP CZ3 HZ3 sing N N 220 TRP CH2 HH2 sing N N 221 TRP OXT HXT sing N N 222 TYR N CA sing N N 223 TYR N H sing N N 224 TYR N H2 sing N N 225 TYR CA C sing N N 226 TYR CA CB sing N N 227 TYR CA HA sing N N 228 TYR C O doub N N 229 TYR C OXT sing N N 230 TYR CB CG sing N N 231 TYR CB HB2 sing N N 232 TYR CB HB3 sing N N 233 TYR CG CD1 doub Y N 234 TYR CG CD2 sing Y N 235 TYR CD1 CE1 sing Y N 236 TYR CD1 HD1 sing N N 237 TYR CD2 CE2 doub Y N 238 TYR CD2 HD2 sing N N 239 TYR CE1 CZ doub Y N 240 TYR CE1 HE1 sing N N 241 TYR CE2 CZ sing Y N 242 TYR CE2 HE2 sing N N 243 TYR CZ OH sing N N 244 TYR OH HH sing N N 245 TYR OXT HXT sing N N 246 VAL N CA sing N N 247 VAL N H sing N N 248 VAL N H2 sing N N 249 VAL CA C sing N N 250 VAL CA CB sing N N 251 VAL CA HA sing N N 252 VAL C O doub N N 253 VAL C OXT sing N N 254 VAL CB CG1 sing N N 255 VAL CB CG2 sing N N 256 VAL CB HB sing N N 257 VAL CG1 HG11 sing N N 258 VAL CG1 HG12 sing N N 259 VAL CG1 HG13 sing N N 260 VAL CG2 HG21 sing N N 261 VAL CG2 HG22 sing N N 262 VAL CG2 HG23 sing N N 263 VAL OXT HXT sing N N 264 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _atom_sites.entry_id 2KDL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ #