data_2KFO # _entry.id 2KFO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KFO pdb_00002kfo 10.2210/pdb2kfo/pdb RCSB RCSB101062 ? ? WWPDB D_1000101062 ? ? BMRB 16185 ? 10.13018/BMR16185 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-06-16 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2021-10-20 5 'Structure model' 1 4 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' pdbx_struct_assembly 6 3 'Structure model' pdbx_struct_oper_list 7 3 'Structure model' struct_ref_seq_dif 8 4 'Structure model' database_2 9 4 'Structure model' struct_ref_seq_dif 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond 12 5 'Structure model' database_2 13 5 'Structure model' pdbx_entry_details 14 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_struct_ref_seq_dif.details' 8 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KFO _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-02-24 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2KFL unspecified 'Tammar Wallaby Prion Protein (121-230)' PDB 2KFM unspecified 'Mouse Prion Protein (121-231) with Mutations Y225A and Y226A' BMRB 16185 unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Christen, B.' 1 'Hornemann, S.' 2 'Damberger, F.F.' 3 'Wuthrich, K.' 4 # _citation.id primary _citation.title ;Prion Protein NMR Structure from Tammar Wallaby (Macropus eugenii) Shows that the beta2-alpha2 Loop Is Modulated by Long-Range Sequence Effects. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 389 _citation.page_first 833 _citation.page_last 845 _citation.year 2009 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19393664 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2009.04.040 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Christen, B.' 1 ? primary 'Hornemann, S.' 2 ? primary 'Damberger, F.F.' 3 ? primary 'Wuthrich, K.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Major prion protein' _entity.formula_weight 13380.824 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation V166A _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PrP, PrP27-30, PrP33-35C' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPADQYSNQNNFVHDCVNITIKQHTVTTTTKGENF TETDVKMMERVVEQMCVTQYQKESQAYYDGRRSS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPADQYSNQNNFVHDCVNITIKQHTVTTTTKGENF TETDVKMMERVVEQMCVTQYQKESQAYYDGRRSS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 VAL n 1 4 VAL n 1 5 GLY n 1 6 GLY n 1 7 LEU n 1 8 GLY n 1 9 GLY n 1 10 TYR n 1 11 MET n 1 12 LEU n 1 13 GLY n 1 14 SER n 1 15 ALA n 1 16 MET n 1 17 SER n 1 18 ARG n 1 19 PRO n 1 20 MET n 1 21 ILE n 1 22 HIS n 1 23 PHE n 1 24 GLY n 1 25 ASN n 1 26 ASP n 1 27 TRP n 1 28 GLU n 1 29 ASP n 1 30 ARG n 1 31 TYR n 1 32 TYR n 1 33 ARG n 1 34 GLU n 1 35 ASN n 1 36 MET n 1 37 TYR n 1 38 ARG n 1 39 TYR n 1 40 PRO n 1 41 ASN n 1 42 GLN n 1 43 VAL n 1 44 TYR n 1 45 TYR n 1 46 ARG n 1 47 PRO n 1 48 ALA n 1 49 ASP n 1 50 GLN n 1 51 TYR n 1 52 SER n 1 53 ASN n 1 54 GLN n 1 55 ASN n 1 56 ASN n 1 57 PHE n 1 58 VAL n 1 59 HIS n 1 60 ASP n 1 61 CYS n 1 62 VAL n 1 63 ASN n 1 64 ILE n 1 65 THR n 1 66 ILE n 1 67 LYS n 1 68 GLN n 1 69 HIS n 1 70 THR n 1 71 VAL n 1 72 THR n 1 73 THR n 1 74 THR n 1 75 THR n 1 76 LYS n 1 77 GLY n 1 78 GLU n 1 79 ASN n 1 80 PHE n 1 81 THR n 1 82 GLU n 1 83 THR n 1 84 ASP n 1 85 VAL n 1 86 LYS n 1 87 MET n 1 88 MET n 1 89 GLU n 1 90 ARG n 1 91 VAL n 1 92 VAL n 1 93 GLU n 1 94 GLN n 1 95 MET n 1 96 CYS n 1 97 VAL n 1 98 THR n 1 99 GLN n 1 100 TYR n 1 101 GLN n 1 102 LYS n 1 103 GLU n 1 104 SER n 1 105 GLN n 1 106 ALA n 1 107 TYR n 1 108 TYR n 1 109 ASP n 1 110 GLY n 1 111 ARG n 1 112 ARG n 1 113 SER n 1 114 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Prn-p, Prnp, Prp' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pRSETA _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 119 119 GLY GLY A . n A 1 2 SER 2 120 120 SER SER A . n A 1 3 VAL 3 121 121 VAL VAL A . n A 1 4 VAL 4 122 122 VAL VAL A . n A 1 5 GLY 5 123 123 GLY GLY A . n A 1 6 GLY 6 124 124 GLY GLY A . n A 1 7 LEU 7 125 125 LEU LEU A . n A 1 8 GLY 8 126 126 GLY GLY A . n A 1 9 GLY 9 127 127 GLY GLY A . n A 1 10 TYR 10 128 128 TYR TYR A . n A 1 11 MET 11 129 129 MET MET A . n A 1 12 LEU 12 130 130 LEU LEU A . n A 1 13 GLY 13 131 131 GLY GLY A . n A 1 14 SER 14 132 132 SER SER A . n A 1 15 ALA 15 133 133 ALA ALA A . n A 1 16 MET 16 134 134 MET MET A . n A 1 17 SER 17 135 135 SER SER A . n A 1 18 ARG 18 136 136 ARG ARG A . n A 1 19 PRO 19 137 137 PRO PRO A . n A 1 20 MET 20 138 138 MET MET A . n A 1 21 ILE 21 139 139 ILE ILE A . n A 1 22 HIS 22 140 140 HIS HIS A . n A 1 23 PHE 23 141 141 PHE PHE A . n A 1 24 GLY 24 142 142 GLY GLY A . n A 1 25 ASN 25 143 143 ASN ASN A . n A 1 26 ASP 26 144 144 ASP ASP A . n A 1 27 TRP 27 145 145 TRP TRP A . n A 1 28 GLU 28 146 146 GLU GLU A . n A 1 29 ASP 29 147 147 ASP ASP A . n A 1 30 ARG 30 148 148 ARG ARG A . n A 1 31 TYR 31 149 149 TYR TYR A . n A 1 32 TYR 32 150 150 TYR TYR A . n A 1 33 ARG 33 151 151 ARG ARG A . n A 1 34 GLU 34 152 152 GLU GLU A . n A 1 35 ASN 35 153 153 ASN ASN A . n A 1 36 MET 36 154 154 MET MET A . n A 1 37 TYR 37 155 155 TYR TYR A . n A 1 38 ARG 38 156 156 ARG ARG A . n A 1 39 TYR 39 157 157 TYR TYR A . n A 1 40 PRO 40 158 158 PRO PRO A . n A 1 41 ASN 41 159 159 ASN ASN A . n A 1 42 GLN 42 160 160 GLN GLN A . n A 1 43 VAL 43 161 161 VAL VAL A . n A 1 44 TYR 44 162 162 TYR TYR A . n A 1 45 TYR 45 163 163 TYR TYR A . n A 1 46 ARG 46 164 164 ARG ARG A . n A 1 47 PRO 47 165 165 PRO PRO A . n A 1 48 ALA 48 166 166 ALA ALA A . n A 1 49 ASP 49 167 167 ASP ASP A . n A 1 50 GLN 50 168 168 GLN GLN A . n A 1 51 TYR 51 169 169 TYR TYR A . n A 1 52 SER 52 170 170 SER SER A . n A 1 53 ASN 53 171 171 ASN ASN A . n A 1 54 GLN 54 172 172 GLN GLN A . n A 1 55 ASN 55 173 173 ASN ASN A . n A 1 56 ASN 56 174 174 ASN ASN A . n A 1 57 PHE 57 175 175 PHE PHE A . n A 1 58 VAL 58 176 176 VAL VAL A . n A 1 59 HIS 59 177 177 HIS HIS A . n A 1 60 ASP 60 178 178 ASP ASP A . n A 1 61 CYS 61 179 179 CYS CYS A . n A 1 62 VAL 62 180 180 VAL VAL A . n A 1 63 ASN 63 181 181 ASN ASN A . n A 1 64 ILE 64 182 182 ILE ILE A . n A 1 65 THR 65 183 183 THR THR A . n A 1 66 ILE 66 184 184 ILE ILE A . n A 1 67 LYS 67 185 185 LYS LYS A . n A 1 68 GLN 68 186 186 GLN GLN A . n A 1 69 HIS 69 187 187 HIS HIS A . n A 1 70 THR 70 188 188 THR THR A . n A 1 71 VAL 71 189 189 VAL VAL A . n A 1 72 THR 72 190 190 THR THR A . n A 1 73 THR 73 191 191 THR THR A . n A 1 74 THR 74 192 192 THR THR A . n A 1 75 THR 75 193 193 THR THR A . n A 1 76 LYS 76 194 194 LYS LYS A . n A 1 77 GLY 77 195 195 GLY GLY A . n A 1 78 GLU 78 196 196 GLU GLU A . n A 1 79 ASN 79 197 197 ASN ASN A . n A 1 80 PHE 80 198 198 PHE PHE A . n A 1 81 THR 81 199 199 THR THR A . n A 1 82 GLU 82 200 200 GLU GLU A . n A 1 83 THR 83 201 201 THR THR A . n A 1 84 ASP 84 202 202 ASP ASP A . n A 1 85 VAL 85 203 203 VAL VAL A . n A 1 86 LYS 86 204 204 LYS LYS A . n A 1 87 MET 87 205 205 MET MET A . n A 1 88 MET 88 206 206 MET MET A . n A 1 89 GLU 89 207 207 GLU GLU A . n A 1 90 ARG 90 208 208 ARG ARG A . n A 1 91 VAL 91 209 209 VAL VAL A . n A 1 92 VAL 92 210 210 VAL VAL A . n A 1 93 GLU 93 211 211 GLU GLU A . n A 1 94 GLN 94 212 212 GLN GLN A . n A 1 95 MET 95 213 213 MET MET A . n A 1 96 CYS 96 214 214 CYS CYS A . n A 1 97 VAL 97 215 215 VAL VAL A . n A 1 98 THR 98 216 216 THR THR A . n A 1 99 GLN 99 217 217 GLN GLN A . n A 1 100 TYR 100 218 218 TYR TYR A . n A 1 101 GLN 101 219 219 GLN GLN A . n A 1 102 LYS 102 220 220 LYS LYS A . n A 1 103 GLU 103 221 221 GLU GLU A . n A 1 104 SER 104 222 222 SER SER A . n A 1 105 GLN 105 223 223 GLN GLN A . n A 1 106 ALA 106 224 224 ALA ALA A . n A 1 107 TYR 107 225 225 TYR TYR A . n A 1 108 TYR 108 226 226 TYR TYR A . n A 1 109 ASP 109 227 227 ASP ASP A . n A 1 110 GLY 110 228 228 GLY GLY A . n A 1 111 ARG 111 229 229 ARG ARG A . n A 1 112 ARG 112 230 230 ARG ARG A . n A 1 113 SER 113 231 231 SER SER A . n A 1 114 SER 114 232 232 SER SER A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KFO _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KFO _struct.title 'Mouse Prion Protein (121-231) with Mutation V166A' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KFO _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text ;Mouse Prion Protein, Mutation V166A, long-range effect, Cell membrane, Glycoprotein, Golgi apparatus, GPI-anchor, Hydroxylation, Lipoprotein, Membrane, Polymorphism, Prion, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PRIO_MOUSE _struct_ref.pdbx_db_accession P04925 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTE TDVKMMERVVEQMCVTQYQKESQAYYDGRRSS ; _struct_ref.pdbx_align_begin 120 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KFO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04925 _struct_ref_seq.db_align_beg 120 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 231 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 121 _struct_ref_seq.pdbx_auth_seq_align_end 232 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KFO GLY A 1 ? UNP P04925 ? ? 'expression tag' 119 1 1 2KFO SER A 2 ? UNP P04925 ? ? 'expression tag' 120 2 1 2KFO ALA A 48 ? UNP P04925 VAL 165 'engineered mutation' 166 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 25 ? MET A 36 ? ASN A 143 MET A 154 1 ? 12 HELX_P HELX_P2 2 TYR A 37 ? TYR A 39 ? TYR A 155 TYR A 157 5 ? 3 HELX_P HELX_P3 3 PRO A 47 ? TYR A 51 ? PRO A 165 TYR A 169 5 ? 5 HELX_P HELX_P4 4 ASN A 53 ? THR A 73 ? ASN A 171 THR A 191 1 ? 21 HELX_P HELX_P5 5 THR A 81 ? GLN A 105 ? THR A 199 GLN A 223 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 61 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 96 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 179 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 214 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.017 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 61 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 96 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 179 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 214 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 11 ? LEU A 12 ? MET A 129 LEU A 130 A 2 TYR A 44 ? TYR A 45 ? TYR A 162 TYR A 163 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id MET _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 11 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id MET _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 129 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 45 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 163 # _pdbx_entry_details.entry_id 2KFO _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH A TYR 149 ? ? OD1 A ASP 202 ? ? 1.57 2 2 HH A TYR 163 ? ? OE2 A GLU 221 ? ? 1.60 3 4 O A GLN 186 ? ? HG1 A THR 190 ? ? 1.56 4 5 HH A TYR 149 ? ? OD1 A ASP 202 ? ? 1.60 5 6 HH A TYR 149 ? ? OD1 A ASP 202 ? ? 1.55 6 6 O A ILE 184 ? ? HG1 A THR 188 ? ? 1.55 7 7 HH A TYR 149 ? ? OD1 A ASP 202 ? ? 1.57 8 7 O A GLN 186 ? ? HG1 A THR 190 ? ? 1.58 9 9 HH A TYR 157 ? ? OD1 A ASP 202 ? ? 1.58 10 10 HH A TYR 149 ? ? OD1 A ASP 202 ? ? 1.50 11 15 O A ILE 184 ? ? HG1 A THR 188 ? ? 1.59 12 18 HH A TYR 226 ? ? OD2 A ASP 227 ? ? 1.59 13 20 HH A TYR 149 ? ? OD1 A ASP 202 ? ? 1.57 14 20 O A GLN 186 ? ? HG1 A THR 190 ? ? 1.59 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH2 A ARG 156 ? ? 117.26 120.30 -3.04 0.50 N 2 2 CA A VAL 215 ? ? CB A VAL 215 ? ? CG1 A VAL 215 ? ? 120.78 110.90 9.88 1.50 N 3 3 CA A VAL 209 ? ? CB A VAL 209 ? ? CG1 A VAL 209 ? ? 125.33 110.90 14.43 1.50 N 4 4 CG1 A VAL 203 ? ? CB A VAL 203 ? ? CG2 A VAL 203 ? ? 123.83 110.90 12.93 1.60 N 5 4 CA A VAL 203 ? ? CB A VAL 203 ? ? CG2 A VAL 203 ? ? 120.88 110.90 9.98 1.50 N 6 5 CA A VAL 161 ? ? CB A VAL 161 ? ? CG1 A VAL 161 ? ? 121.37 110.90 10.47 1.50 N 7 9 CA A VAL 209 ? ? CB A VAL 209 ? ? CG1 A VAL 209 ? ? 120.87 110.90 9.97 1.50 N 8 10 CA A VAL 209 ? ? CB A VAL 209 ? ? CG1 A VAL 209 ? ? 121.91 110.90 11.01 1.50 N 9 11 CA A VAL 209 ? ? CB A VAL 209 ? ? CG1 A VAL 209 ? ? 120.84 110.90 9.94 1.50 N 10 14 CA A VAL 209 ? ? CB A VAL 209 ? ? CG1 A VAL 209 ? ? 123.04 110.90 12.14 1.50 N 11 18 NE A ARG 148 ? ? CZ A ARG 148 ? ? NH2 A ARG 148 ? ? 117.29 120.30 -3.01 0.50 N 12 18 CA A VAL 209 ? ? CB A VAL 209 ? ? CG2 A VAL 209 ? ? 120.03 110.90 9.13 1.50 N 13 20 CB A LEU 125 ? ? CG A LEU 125 ? ? CD1 A LEU 125 ? ? 98.89 111.00 -12.11 1.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 120 ? ? -90.65 34.76 2 1 VAL A 121 ? ? -24.91 98.22 3 1 MET A 134 ? ? -115.88 -149.71 4 1 PRO A 137 ? ? -67.55 -174.60 5 1 PHE A 141 ? ? 59.29 11.10 6 1 SER A 170 ? ? -160.44 -41.18 7 1 LYS A 194 ? ? -133.86 -127.63 8 1 PHE A 198 ? ? 38.81 98.15 9 1 ALA A 224 ? ? -141.65 11.13 10 1 ARG A 230 ? ? -116.53 75.61 11 2 VAL A 121 ? ? -32.51 131.88 12 2 PHE A 141 ? ? 55.78 6.64 13 2 SER A 170 ? ? -164.02 -70.04 14 2 ASN A 171 ? ? -69.17 -177.11 15 2 LYS A 194 ? ? -89.72 -138.41 16 2 PHE A 198 ? ? 44.27 90.37 17 3 SER A 120 ? ? -97.25 59.80 18 3 VAL A 121 ? ? -33.24 118.59 19 3 PRO A 137 ? ? -69.33 -171.36 20 3 PHE A 141 ? ? 55.20 8.00 21 3 TYR A 169 ? ? -119.07 -168.29 22 3 SER A 170 ? ? -165.24 -69.77 23 3 THR A 191 ? ? -57.89 -3.95 24 3 LYS A 194 ? ? -119.80 -147.35 25 3 GLU A 196 ? ? -69.78 65.22 26 3 PHE A 198 ? ? 50.99 94.52 27 3 ARG A 230 ? ? -67.95 15.33 28 4 SER A 120 ? ? -140.64 48.90 29 4 VAL A 121 ? ? -30.17 112.02 30 4 MET A 129 ? ? -105.27 -168.25 31 4 PHE A 141 ? ? 59.59 3.11 32 4 SER A 170 ? ? -141.20 -76.67 33 4 LYS A 194 ? ? -124.18 -115.40 34 4 PHE A 198 ? ? 42.63 104.02 35 4 ARG A 229 ? ? 37.95 68.35 36 4 ARG A 230 ? ? -108.82 46.96 37 5 VAL A 121 ? ? -35.97 127.12 38 5 MET A 134 ? ? -109.38 -158.90 39 5 ARG A 136 ? ? 24.20 89.04 40 5 PHE A 141 ? ? 56.22 3.99 41 5 ASP A 167 ? ? -65.18 18.77 42 5 SER A 170 ? ? -157.80 -32.45 43 5 THR A 191 ? ? -60.71 0.78 44 5 LYS A 194 ? ? -83.54 -124.88 45 5 GLU A 196 ? ? -112.33 57.67 46 5 PHE A 198 ? ? 47.23 91.99 47 5 ARG A 230 ? ? -81.23 49.85 48 6 VAL A 121 ? ? -27.04 109.52 49 6 PHE A 141 ? ? 57.61 4.77 50 6 SER A 170 ? ? -150.22 -84.80 51 6 LYS A 194 ? ? -89.77 -114.51 52 6 GLU A 196 ? ? -111.57 69.41 53 6 PHE A 198 ? ? 51.91 98.03 54 7 SER A 120 ? ? -101.38 67.75 55 7 VAL A 121 ? ? -34.85 136.76 56 7 PRO A 137 ? ? -67.52 -179.77 57 7 PHE A 141 ? ? 55.01 6.11 58 7 TYR A 163 ? ? -173.87 146.86 59 7 TYR A 169 ? ? -119.76 -157.61 60 7 SER A 170 ? ? -168.20 -37.50 61 7 ASN A 173 ? ? -29.98 -54.98 62 7 LYS A 194 ? ? -109.06 -132.55 63 7 PHE A 198 ? ? 59.33 125.10 64 7 ARG A 229 ? ? 38.41 48.66 65 8 SER A 120 ? ? 89.07 53.92 66 8 VAL A 121 ? ? -30.20 122.18 67 8 PRO A 137 ? ? -65.23 -174.94 68 8 HIS A 140 ? ? -141.80 -6.16 69 8 PHE A 141 ? ? 52.66 9.75 70 8 ASN A 171 ? ? -170.25 145.88 71 8 ILE A 184 ? ? -60.15 -70.23 72 8 LYS A 194 ? ? -132.53 -127.25 73 8 PHE A 198 ? ? 47.74 94.82 74 8 GLU A 207 ? ? -67.93 2.63 75 8 ALA A 224 ? ? -141.86 18.82 76 8 ARG A 230 ? ? -92.32 50.18 77 9 SER A 120 ? ? -86.00 43.91 78 9 VAL A 121 ? ? -26.55 109.49 79 9 PRO A 137 ? ? -68.32 -168.56 80 9 PHE A 141 ? ? 58.14 8.33 81 9 ILE A 182 ? ? -63.62 -71.91 82 9 LYS A 194 ? ? -129.18 -144.17 83 9 GLU A 196 ? ? -69.99 58.91 84 9 PHE A 198 ? ? 53.72 100.18 85 10 VAL A 121 ? ? -34.39 123.74 86 10 PRO A 137 ? ? -68.36 -170.70 87 10 PHE A 141 ? ? 56.96 6.36 88 10 SER A 170 ? ? -148.62 -20.30 89 10 THR A 191 ? ? -56.82 -8.89 90 10 LYS A 194 ? ? -81.76 -141.77 91 10 PHE A 198 ? ? 55.91 98.99 92 10 ASP A 227 ? ? -142.79 10.85 93 10 ARG A 229 ? ? 64.03 107.58 94 11 SER A 120 ? ? -145.11 53.47 95 11 VAL A 121 ? ? -27.20 110.03 96 11 SER A 132 ? ? 57.27 170.49 97 11 PRO A 137 ? ? -70.03 -168.79 98 11 PHE A 141 ? ? 57.44 9.88 99 11 GLU A 152 ? ? -75.59 -71.40 100 11 SER A 170 ? ? -158.70 -2.77 101 11 LYS A 194 ? ? -131.40 -126.96 102 11 GLU A 196 ? ? -114.41 62.82 103 11 PHE A 198 ? ? 49.88 91.28 104 11 ARG A 229 ? ? 38.07 87.81 105 12 SER A 120 ? ? 83.92 64.15 106 12 VAL A 121 ? ? -28.50 130.28 107 12 PRO A 137 ? ? -73.18 -169.25 108 12 PHE A 141 ? ? 54.51 18.97 109 12 SER A 170 ? ? -143.22 -8.49 110 12 LYS A 194 ? ? -90.90 -143.26 111 12 GLU A 196 ? ? -69.66 66.80 112 12 PHE A 198 ? ? 39.90 93.96 113 12 ARG A 229 ? ? 32.43 70.76 114 13 VAL A 121 ? ? -31.54 127.83 115 13 MET A 134 ? ? -122.52 -157.57 116 13 ARG A 136 ? ? -37.06 118.51 117 13 PHE A 141 ? ? 57.90 5.96 118 13 TYR A 163 ? ? -172.16 146.40 119 13 SER A 170 ? ? -161.59 8.82 120 13 LYS A 194 ? ? -81.82 -143.63 121 13 PHE A 198 ? ? 58.28 100.23 122 13 ARG A 229 ? ? 33.48 52.76 123 14 SER A 120 ? ? -90.64 48.36 124 14 VAL A 121 ? ? -24.41 111.72 125 14 MET A 134 ? ? -121.09 -161.81 126 14 ARG A 136 ? ? -28.39 117.75 127 14 PRO A 137 ? ? -65.21 -177.90 128 14 TYR A 169 ? ? -124.06 -168.22 129 14 SER A 170 ? ? -159.86 -85.49 130 14 ASN A 171 ? ? -69.72 -171.84 131 14 THR A 191 ? ? -56.85 0.83 132 14 THR A 193 ? ? -150.17 -11.30 133 14 LYS A 194 ? ? -87.63 -95.33 134 14 PHE A 198 ? ? 56.85 96.03 135 15 SER A 120 ? ? -144.13 53.31 136 15 VAL A 121 ? ? -31.46 111.97 137 15 MET A 134 ? ? -121.97 -159.20 138 15 ARG A 136 ? ? -37.97 118.88 139 15 PRO A 137 ? ? -67.19 -174.31 140 15 HIS A 140 ? ? -162.54 92.39 141 15 PHE A 141 ? ? -52.36 -2.28 142 15 LYS A 194 ? ? -122.26 -133.21 143 15 PHE A 198 ? ? 52.33 94.48 144 15 ARG A 229 ? ? 37.89 75.23 145 15 ARG A 230 ? ? -114.56 55.89 146 16 VAL A 121 ? ? -30.22 121.57 147 16 PHE A 141 ? ? 54.04 8.77 148 16 TYR A 163 ? ? -175.15 149.57 149 16 SER A 170 ? ? -158.22 -3.66 150 16 LYS A 194 ? ? -105.85 -131.11 151 16 PHE A 198 ? ? 54.38 98.87 152 16 ARG A 229 ? ? 58.46 72.32 153 16 SER A 231 ? ? -117.58 65.70 154 17 SER A 120 ? ? -150.12 66.78 155 17 VAL A 121 ? ? -32.94 118.15 156 17 SER A 132 ? ? 45.06 -164.16 157 17 MET A 134 ? ? -135.08 -152.23 158 17 ARG A 136 ? ? -39.30 105.33 159 17 PHE A 141 ? ? 53.57 13.05 160 17 ASP A 167 ? ? -57.48 -4.41 161 17 THR A 193 ? ? -149.08 -7.15 162 17 LYS A 194 ? ? -92.22 -138.14 163 17 PHE A 198 ? ? 57.89 104.10 164 17 ARG A 230 ? ? -92.69 52.55 165 18 VAL A 121 ? ? -33.80 136.20 166 18 PRO A 137 ? ? -67.72 -170.75 167 18 TYR A 169 ? ? -123.72 -162.82 168 18 SER A 170 ? ? -165.48 -77.69 169 18 THR A 191 ? ? -58.71 -5.73 170 18 THR A 193 ? ? -132.84 -31.68 171 18 LYS A 194 ? ? -87.63 -117.08 172 18 PHE A 198 ? ? 50.77 97.72 173 19 SER A 120 ? ? -114.59 50.73 174 19 VAL A 121 ? ? -30.60 122.52 175 19 PRO A 137 ? ? -69.89 -176.15 176 19 PHE A 141 ? ? 57.29 9.83 177 19 TYR A 169 ? ? -124.88 -161.06 178 19 SER A 170 ? ? -162.31 -59.25 179 19 THR A 191 ? ? -59.97 -8.33 180 19 THR A 193 ? ? -140.24 -18.33 181 19 LYS A 194 ? ? -119.23 -137.68 182 19 GLU A 196 ? ? -69.87 66.93 183 19 PHE A 198 ? ? 53.74 92.95 184 19 ARG A 230 ? ? -89.61 47.95 185 20 SER A 120 ? ? -74.89 43.03 186 20 VAL A 121 ? ? -35.57 116.75 187 20 SER A 132 ? ? 48.29 -171.85 188 20 PRO A 137 ? ? -71.16 -163.88 189 20 PHE A 141 ? ? 55.16 2.64 190 20 ASN A 171 ? ? 52.06 -174.32 191 20 THR A 188 ? ? -59.82 -2.98 192 20 GLU A 196 ? ? -67.84 66.58 193 20 PHE A 198 ? ? 49.28 95.85 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 TYR A 157 ? ? 0.068 'SIDE CHAIN' 2 3 TYR A 226 ? ? 0.073 'SIDE CHAIN' 3 4 ARG A 151 ? ? 0.122 'SIDE CHAIN' 4 5 TYR A 128 ? ? 0.094 'SIDE CHAIN' 5 5 TYR A 157 ? ? 0.074 'SIDE CHAIN' 6 5 ARG A 229 ? ? 0.084 'SIDE CHAIN' 7 6 TYR A 155 ? ? 0.069 'SIDE CHAIN' 8 6 TYR A 163 ? ? 0.071 'SIDE CHAIN' 9 6 TYR A 226 ? ? 0.107 'SIDE CHAIN' 10 7 ARG A 148 ? ? 0.091 'SIDE CHAIN' 11 7 TYR A 226 ? ? 0.110 'SIDE CHAIN' 12 7 ARG A 229 ? ? 0.106 'SIDE CHAIN' 13 8 ARG A 148 ? ? 0.080 'SIDE CHAIN' 14 8 ARG A 151 ? ? 0.077 'SIDE CHAIN' 15 8 TYR A 155 ? ? 0.072 'SIDE CHAIN' 16 9 ARG A 136 ? ? 0.106 'SIDE CHAIN' 17 9 ARG A 148 ? ? 0.098 'SIDE CHAIN' 18 10 ARG A 151 ? ? 0.079 'SIDE CHAIN' 19 10 ARG A 156 ? ? 0.125 'SIDE CHAIN' 20 10 TYR A 169 ? ? 0.077 'SIDE CHAIN' 21 10 TYR A 226 ? ? 0.078 'SIDE CHAIN' 22 11 TYR A 128 ? ? 0.128 'SIDE CHAIN' 23 11 ARG A 151 ? ? 0.115 'SIDE CHAIN' 24 11 ARG A 156 ? ? 0.077 'SIDE CHAIN' 25 12 ARG A 164 ? ? 0.081 'SIDE CHAIN' 26 13 TYR A 226 ? ? 0.069 'SIDE CHAIN' 27 14 ARG A 148 ? ? 0.082 'SIDE CHAIN' 28 14 ARG A 164 ? ? 0.126 'SIDE CHAIN' 29 15 ARG A 156 ? ? 0.099 'SIDE CHAIN' 30 16 TYR A 155 ? ? 0.069 'SIDE CHAIN' 31 16 TYR A 163 ? ? 0.071 'SIDE CHAIN' 32 16 TYR A 169 ? ? 0.143 'SIDE CHAIN' 33 16 ARG A 230 ? ? 0.084 'SIDE CHAIN' 34 17 TYR A 128 ? ? 0.077 'SIDE CHAIN' 35 17 ARG A 151 ? ? 0.141 'SIDE CHAIN' 36 17 ARG A 229 ? ? 0.096 'SIDE CHAIN' 37 18 TYR A 157 ? ? 0.088 'SIDE CHAIN' 38 18 TYR A 162 ? ? 0.103 'SIDE CHAIN' 39 19 TYR A 157 ? ? 0.075 'SIDE CHAIN' 40 19 TYR A 169 ? ? 0.088 'SIDE CHAIN' 41 19 ARG A 229 ? ? 0.081 'SIDE CHAIN' 42 20 TYR A 218 ? ? 0.073 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KFO _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KFO _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.contents '1.4 mM [U-99% 13C; U-99% 15N] protein, 10 mM [U-100% 2H] sodium acetate, 0.02 % sodium azide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein 1.4 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium acetate' 10 ? mM '[U-100% 2H]' 1 'sodium azide' 0.02 ? % ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.01 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293.1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' 1 3 1 '3D HNCA' 1 4 1 '3D CBCA(CO)NH' # _pdbx_nmr_refine.entry_id 2KFO _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Keller and Wuthrich' 'data analysis' CARA ? 1 'Herrmann, Guntert and Wuthrich' 'peak picking' ATNOS/CANDID 1.2 2 'Herrmann, Guntert and Wuthrich' 'chemical shift assignment' ATNOS/CANDID 1.2 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' DYANA 1.0.3 4 'Luginbuhl, Guntert, Billeter and Wuthrich' refinement OPALp ? 5 'Koradi, Billeter and Wuthrich' 'data analysis' MOLMOL ? 6 'Bruker Biospin' collection TopSpin ? 7 'Bruker Biospin' processing TopSpin ? 8 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 750 Bruker AVANCE 2 'Bruker Avance' 900 Bruker AVANCE 3 'Bruker Avance' # _atom_sites.entry_id 2KFO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #