data_2KFY # _entry.id 2KFY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KFY pdb_00002kfy 10.2210/pdb2kfy/pdb RCSB RCSB101072 ? ? BMRB 16192 ? ? WWPDB D_1000101072 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 6745 BMRB 'Backbone 1H, 13C, and 15N chemical shift assignments of human HnRNP F qRRM12' unspecified 2HGL PDB 'NMR structure of the first qRRM domain of human hnRNP F' unspecified 16192 BMRB . unspecified 2KG0 PDB . unspecified 2KG1 PDB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KFY _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-03-02 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Allain, F.H.T.' 1 'Dominguez, C.' 2 # _citation.id primary _citation.title 'Structural basis of G-tract recognition and encaging by hnRNP F quasi-RRMs.' _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_volume 17 _citation.page_first 853 _citation.page_last 861 _citation.year 2010 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1545-9993 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20526337 _citation.pdbx_database_id_DOI 10.1038/nsmb.1814 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dominguez, C.' 1 ? primary 'Fisette, J.F.' 2 ? primary 'Chabot, B.' 3 ? primary 'Allain, F.H.' 4 ? # _cell.entry_id 2KFY _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2KFY _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Heterogeneous nuclear ribonucleoprotein F' 15027.921 1 ? ? ? ? 2 polymer syn "5'-R(*AP*GP*GP*GP*AP*U)-3'" 1955.237 1 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name 'hnRNP F, Nucleolin-like protein mcs94-1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFI YTREGRQSGEAFVELGSEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGP ; ;MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFI YTREGRQSGEAFVELGSEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGP ; A ? 2 polyribonucleotide no no AGGGAU AGGGAU B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ALA n 1 23 SER n 1 24 MET n 1 25 THR n 1 26 GLY n 1 27 GLY n 1 28 GLN n 1 29 GLN n 1 30 MET n 1 31 GLY n 1 32 ARG n 1 33 GLY n 1 34 SER n 1 35 MET n 1 36 MET n 1 37 LEU n 1 38 GLY n 1 39 PRO n 1 40 GLU n 1 41 GLY n 1 42 GLY n 1 43 GLU n 1 44 GLY n 1 45 PHE n 1 46 VAL n 1 47 VAL n 1 48 LYS n 1 49 LEU n 1 50 ARG n 1 51 GLY n 1 52 LEU n 1 53 PRO n 1 54 TRP n 1 55 SER n 1 56 CYS n 1 57 SER n 1 58 VAL n 1 59 GLU n 1 60 ASP n 1 61 VAL n 1 62 GLN n 1 63 ASN n 1 64 PHE n 1 65 LEU n 1 66 SER n 1 67 ASP n 1 68 CYS n 1 69 THR n 1 70 ILE n 1 71 HIS n 1 72 ASP n 1 73 GLY n 1 74 ALA n 1 75 ALA n 1 76 GLY n 1 77 VAL n 1 78 HIS n 1 79 PHE n 1 80 ILE n 1 81 TYR n 1 82 THR n 1 83 ARG n 1 84 GLU n 1 85 GLY n 1 86 ARG n 1 87 GLN n 1 88 SER n 1 89 GLY n 1 90 GLU n 1 91 ALA n 1 92 PHE n 1 93 VAL n 1 94 GLU n 1 95 LEU n 1 96 GLY n 1 97 SER n 1 98 GLU n 1 99 ASP n 1 100 ASP n 1 101 VAL n 1 102 LYS n 1 103 MET n 1 104 ALA n 1 105 LEU n 1 106 LYS n 1 107 LYS n 1 108 ASP n 1 109 ARG n 1 110 GLU n 1 111 SER n 1 112 MET n 1 113 GLY n 1 114 HIS n 1 115 ARG n 1 116 TYR n 1 117 ILE n 1 118 GLU n 1 119 VAL n 1 120 PHE n 1 121 LYS n 1 122 SER n 1 123 HIS n 1 124 ARG n 1 125 THR n 1 126 GLU n 1 127 MET n 1 128 ASP n 1 129 TRP n 1 130 VAL n 1 131 LEU n 1 132 LYS n 1 133 HIS n 1 134 SER n 1 135 GLY n 1 136 PRO n 2 1 A n 2 2 G n 2 3 G n 2 4 G n 2 5 A n 2 6 U n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 Codon Plus' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP HNRPF_HUMAN P52597 1 ;MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMALKKDRESMGH RYIEVFKSHRTEMDWVLKHSGP ; 1 ? 2 PDB 2KFY 2KFY 2 AGGGAU ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2KFY A 35 ? 136 ? P52597 1 ? 102 ? 1 102 2 2 2KFY B 1 ? 6 ? 2KFY 1 ? 6 ? 1 6 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KFY MET A 1 ? UNP P52597 ? ? 'expression tag' -33 1 1 2KFY GLY A 2 ? UNP P52597 ? ? 'expression tag' -32 2 1 2KFY SER A 3 ? UNP P52597 ? ? 'expression tag' -31 3 1 2KFY SER A 4 ? UNP P52597 ? ? 'expression tag' -30 4 1 2KFY HIS A 5 ? UNP P52597 ? ? 'expression tag' -29 5 1 2KFY HIS A 6 ? UNP P52597 ? ? 'expression tag' -28 6 1 2KFY HIS A 7 ? UNP P52597 ? ? 'expression tag' -27 7 1 2KFY HIS A 8 ? UNP P52597 ? ? 'expression tag' -26 8 1 2KFY HIS A 9 ? UNP P52597 ? ? 'expression tag' -25 9 1 2KFY HIS A 10 ? UNP P52597 ? ? 'expression tag' -24 10 1 2KFY SER A 11 ? UNP P52597 ? ? 'expression tag' -23 11 1 2KFY SER A 12 ? UNP P52597 ? ? 'expression tag' -22 12 1 2KFY GLY A 13 ? UNP P52597 ? ? 'expression tag' -21 13 1 2KFY LEU A 14 ? UNP P52597 ? ? 'expression tag' -20 14 1 2KFY VAL A 15 ? UNP P52597 ? ? 'expression tag' -19 15 1 2KFY PRO A 16 ? UNP P52597 ? ? 'expression tag' -18 16 1 2KFY ARG A 17 ? UNP P52597 ? ? 'expression tag' -17 17 1 2KFY GLY A 18 ? UNP P52597 ? ? 'expression tag' -16 18 1 2KFY SER A 19 ? UNP P52597 ? ? 'expression tag' -15 19 1 2KFY HIS A 20 ? UNP P52597 ? ? 'expression tag' -14 20 1 2KFY MET A 21 ? UNP P52597 ? ? 'expression tag' -13 21 1 2KFY ALA A 22 ? UNP P52597 ? ? 'expression tag' -12 22 1 2KFY SER A 23 ? UNP P52597 ? ? 'expression tag' -11 23 1 2KFY MET A 24 ? UNP P52597 ? ? 'expression tag' -10 24 1 2KFY THR A 25 ? UNP P52597 ? ? 'expression tag' -9 25 1 2KFY GLY A 26 ? UNP P52597 ? ? 'expression tag' -8 26 1 2KFY GLY A 27 ? UNP P52597 ? ? 'expression tag' -7 27 1 2KFY GLN A 28 ? UNP P52597 ? ? 'expression tag' -6 28 1 2KFY GLN A 29 ? UNP P52597 ? ? 'expression tag' -5 29 1 2KFY MET A 30 ? UNP P52597 ? ? 'expression tag' -4 30 1 2KFY GLY A 31 ? UNP P52597 ? ? 'expression tag' -3 31 1 2KFY ARG A 32 ? UNP P52597 ? ? 'expression tag' -2 32 1 2KFY GLY A 33 ? UNP P52597 ? ? 'expression tag' -1 33 1 2KFY SER A 34 ? UNP P52597 ? ? 'expression tag' 0 34 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A 'RNA linking' y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D 1H-15N NOESY' 1 4 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 70 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;1-1.5 mM [U-13C; U-15N] hnRNP F, 1-1.5 mM RNA (5'-R(*AP*GP*GP*GP*AP*U)-3')-2, 93% H2O/7% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' 700 Bruker AVANCE 3 'Bruker Avance' 900 Bruker AVANCE 4 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KFY _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KFY _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KFY _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Goddard 'chemical shift assignment' Sparky 3.113 1 'Herrmann, Guntert and Wuthrich' 'structure solution' CYANA 2.1 2 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' refinement Amber 7.0 3 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KFY _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KFY _struct.title 'NMR structure of the first qRRM of hnRNP F in complex with AGGGAU G-tract RNA' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KFY _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN/RNA' _struct_keywords.text ;protein-RNA complex, G tract, splicing regulation, polyadenylation regulation, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, Ribonucleoprotein, RNA-binding, Spliceosome, RNA BINDING PROTEIN-RNA COMPLEX ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 57 ? LEU A 65 ? SER A 23 LEU A 31 1 ? 9 HELX_P HELX_P2 2 SER A 97 ? LYS A 106 ? SER A 63 LYS A 72 1 ? 10 HELX_P HELX_P3 3 ARG A 124 ? LEU A 131 ? ARG A 90 LEU A 97 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id hydrog1 _struct_conn.conn_type_id hydrog _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id G _struct_conn.ptnr1_label_seq_id 2 _struct_conn.ptnr1_label_atom_id N2 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id G _struct_conn.ptnr2_label_seq_id 4 _struct_conn.ptnr2_label_atom_id O6 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id B _struct_conn.ptnr1_auth_comp_id G _struct_conn.ptnr1_auth_seq_id 2 _struct_conn.ptnr2_auth_asym_id B _struct_conn.ptnr2_auth_comp_id G _struct_conn.ptnr2_auth_seq_id 4 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details 'G-G MISPAIR' _struct_conn.pdbx_dist_value ? _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id hydrog _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 135 A . ? GLY 101 A PRO 136 A ? PRO 102 A 3 -0.22 2 PRO 53 A . ? PRO 19 A TRP 54 A ? TRP 20 A 5 -0.02 3 GLY 85 A . ? GLY 51 A ARG 86 A ? ARG 52 A 11 4.06 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 77 ? THR A 82 ? VAL A 43 THR A 48 A 2 ARG A 86 ? GLU A 94 ? ARG A 52 GLU A 60 A 3 VAL A 46 ? GLY A 51 ? VAL A 12 GLY A 17 A 4 ILE A 117 ? LYS A 121 ? ILE A 83 LYS A 87 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 80 ? N ILE A 46 O SER A 88 ? O SER A 54 A 2 3 O VAL A 93 ? O VAL A 59 N VAL A 47 ? N VAL A 13 A 3 4 N LYS A 48 ? N LYS A 14 O PHE A 120 ? O PHE A 86 # _atom_sites.entry_id 2KFY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -33 ? ? ? A . n A 1 2 GLY 2 -32 ? ? ? A . n A 1 3 SER 3 -31 ? ? ? A . n A 1 4 SER 4 -30 ? ? ? A . n A 1 5 HIS 5 -29 ? ? ? A . n A 1 6 HIS 6 -28 ? ? ? A . n A 1 7 HIS 7 -27 ? ? ? A . n A 1 8 HIS 8 -26 ? ? ? A . n A 1 9 HIS 9 -25 ? ? ? A . n A 1 10 HIS 10 -24 ? ? ? A . n A 1 11 SER 11 -23 ? ? ? A . n A 1 12 SER 12 -22 ? ? ? A . n A 1 13 GLY 13 -21 ? ? ? A . n A 1 14 LEU 14 -20 ? ? ? A . n A 1 15 VAL 15 -19 ? ? ? A . n A 1 16 PRO 16 -18 ? ? ? A . n A 1 17 ARG 17 -17 ? ? ? A . n A 1 18 GLY 18 -16 ? ? ? A . n A 1 19 SER 19 -15 ? ? ? A . n A 1 20 HIS 20 -14 ? ? ? A . n A 1 21 MET 21 -13 ? ? ? A . n A 1 22 ALA 22 -12 ? ? ? A . n A 1 23 SER 23 -11 ? ? ? A . n A 1 24 MET 24 -10 ? ? ? A . n A 1 25 THR 25 -9 ? ? ? A . n A 1 26 GLY 26 -8 ? ? ? A . n A 1 27 GLY 27 -7 ? ? ? A . n A 1 28 GLN 28 -6 ? ? ? A . n A 1 29 GLN 29 -5 ? ? ? A . n A 1 30 MET 30 -4 ? ? ? A . n A 1 31 GLY 31 -3 ? ? ? A . n A 1 32 ARG 32 -2 ? ? ? A . n A 1 33 GLY 33 -1 ? ? ? A . n A 1 34 SER 34 0 ? ? ? A . n A 1 35 MET 35 1 1 MET MET A . n A 1 36 MET 36 2 2 MET MET A . n A 1 37 LEU 37 3 3 LEU LEU A . n A 1 38 GLY 38 4 4 GLY GLY A . n A 1 39 PRO 39 5 5 PRO PRO A . n A 1 40 GLU 40 6 6 GLU GLU A . n A 1 41 GLY 41 7 7 GLY GLY A . n A 1 42 GLY 42 8 8 GLY GLY A . n A 1 43 GLU 43 9 9 GLU GLU A . n A 1 44 GLY 44 10 10 GLY GLY A . n A 1 45 PHE 45 11 11 PHE PHE A . n A 1 46 VAL 46 12 12 VAL VAL A . n A 1 47 VAL 47 13 13 VAL VAL A . n A 1 48 LYS 48 14 14 LYS LYS A . n A 1 49 LEU 49 15 15 LEU LEU A . n A 1 50 ARG 50 16 16 ARG ARG A . n A 1 51 GLY 51 17 17 GLY GLY A . n A 1 52 LEU 52 18 18 LEU LEU A . n A 1 53 PRO 53 19 19 PRO PRO A . n A 1 54 TRP 54 20 20 TRP TRP A . n A 1 55 SER 55 21 21 SER SER A . n A 1 56 CYS 56 22 22 CYS CYS A . n A 1 57 SER 57 23 23 SER SER A . n A 1 58 VAL 58 24 24 VAL VAL A . n A 1 59 GLU 59 25 25 GLU GLU A . n A 1 60 ASP 60 26 26 ASP ASP A . n A 1 61 VAL 61 27 27 VAL VAL A . n A 1 62 GLN 62 28 28 GLN GLN A . n A 1 63 ASN 63 29 29 ASN ASN A . n A 1 64 PHE 64 30 30 PHE PHE A . n A 1 65 LEU 65 31 31 LEU LEU A . n A 1 66 SER 66 32 32 SER SER A . n A 1 67 ASP 67 33 33 ASP ASP A . n A 1 68 CYS 68 34 34 CYS CYS A . n A 1 69 THR 69 35 35 THR THR A . n A 1 70 ILE 70 36 36 ILE ILE A . n A 1 71 HIS 71 37 37 HIS HIS A . n A 1 72 ASP 72 38 38 ASP ASP A . n A 1 73 GLY 73 39 39 GLY GLY A . n A 1 74 ALA 74 40 40 ALA ALA A . n A 1 75 ALA 75 41 41 ALA ALA A . n A 1 76 GLY 76 42 42 GLY GLY A . n A 1 77 VAL 77 43 43 VAL VAL A . n A 1 78 HIS 78 44 44 HIS HIS A . n A 1 79 PHE 79 45 45 PHE PHE A . n A 1 80 ILE 80 46 46 ILE ILE A . n A 1 81 TYR 81 47 47 TYR TYR A . n A 1 82 THR 82 48 48 THR THR A . n A 1 83 ARG 83 49 49 ARG ARG A . n A 1 84 GLU 84 50 50 GLU GLU A . n A 1 85 GLY 85 51 51 GLY GLY A . n A 1 86 ARG 86 52 52 ARG ARG A . n A 1 87 GLN 87 53 53 GLN GLN A . n A 1 88 SER 88 54 54 SER SER A . n A 1 89 GLY 89 55 55 GLY GLY A . n A 1 90 GLU 90 56 56 GLU GLU A . n A 1 91 ALA 91 57 57 ALA ALA A . n A 1 92 PHE 92 58 58 PHE PHE A . n A 1 93 VAL 93 59 59 VAL VAL A . n A 1 94 GLU 94 60 60 GLU GLU A . n A 1 95 LEU 95 61 61 LEU LEU A . n A 1 96 GLY 96 62 62 GLY GLY A . n A 1 97 SER 97 63 63 SER SER A . n A 1 98 GLU 98 64 64 GLU GLU A . n A 1 99 ASP 99 65 65 ASP ASP A . n A 1 100 ASP 100 66 66 ASP ASP A . n A 1 101 VAL 101 67 67 VAL VAL A . n A 1 102 LYS 102 68 68 LYS LYS A . n A 1 103 MET 103 69 69 MET MET A . n A 1 104 ALA 104 70 70 ALA ALA A . n A 1 105 LEU 105 71 71 LEU LEU A . n A 1 106 LYS 106 72 72 LYS LYS A . n A 1 107 LYS 107 73 73 LYS LYS A . n A 1 108 ASP 108 74 74 ASP ASP A . n A 1 109 ARG 109 75 75 ARG ARG A . n A 1 110 GLU 110 76 76 GLU GLU A . n A 1 111 SER 111 77 77 SER SER A . n A 1 112 MET 112 78 78 MET MET A . n A 1 113 GLY 113 79 79 GLY GLY A . n A 1 114 HIS 114 80 80 HIS HIS A . n A 1 115 ARG 115 81 81 ARG ARG A . n A 1 116 TYR 116 82 82 TYR TYR A . n A 1 117 ILE 117 83 83 ILE ILE A . n A 1 118 GLU 118 84 84 GLU GLU A . n A 1 119 VAL 119 85 85 VAL VAL A . n A 1 120 PHE 120 86 86 PHE PHE A . n A 1 121 LYS 121 87 87 LYS LYS A . n A 1 122 SER 122 88 88 SER SER A . n A 1 123 HIS 123 89 89 HIS HIS A . n A 1 124 ARG 124 90 90 ARG ARG A . n A 1 125 THR 125 91 91 THR THR A . n A 1 126 GLU 126 92 92 GLU GLU A . n A 1 127 MET 127 93 93 MET MET A . n A 1 128 ASP 128 94 94 ASP ASP A . n A 1 129 TRP 129 95 95 TRP TRP A . n A 1 130 VAL 130 96 96 VAL VAL A . n A 1 131 LEU 131 97 97 LEU LEU A . n A 1 132 LYS 132 98 98 LYS LYS A . n A 1 133 HIS 133 99 99 HIS HIS A . n A 1 134 SER 134 100 100 SER SER A . n A 1 135 GLY 135 101 101 GLY GLY A . n A 1 136 PRO 136 102 102 PRO PRO A . n B 2 1 A 1 1 1 A A B . n B 2 2 G 2 2 2 G G B . n B 2 3 G 3 3 3 G G B . n B 2 4 G 4 4 4 G G B . n B 2 5 A 5 5 5 A A B . n B 2 6 U 6 6 6 U U B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-06-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'hnRNP F qRRM1-1' ? 1-1.5 mM '[U-13C; U-15N]' 1 ;RNA (5'-R(*AP*GP*GP*GP*AP*U)-3')-2 ; ? 1-1.5 mM ? 1 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 12 _pdbx_validate_close_contact.auth_atom_id_1 "HO2'" _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 G _pdbx_validate_close_contact.auth_seq_id_1 4 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OP1 _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 A _pdbx_validate_close_contact.auth_seq_id_2 5 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.57 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 "O4'" B G 4 ? ? "C1'" B G 4 ? ? N9 B G 4 ? ? 112.89 108.50 4.39 0.70 N 2 2 CB A TYR 82 ? ? CG A TYR 82 ? ? CD2 A TYR 82 ? ? 116.08 121.00 -4.92 0.60 N 3 2 "C1'" B A 1 ? ? "O4'" B A 1 ? ? "C4'" B A 1 ? ? 105.02 109.70 -4.68 0.70 N 4 2 "O4'" B A 1 ? ? "C1'" B A 1 ? ? "C2'" B A 1 ? ? 97.35 105.80 -8.45 1.00 N 5 2 "O4'" B A 1 ? ? "C1'" B A 1 ? ? N9 B A 1 ? ? 117.14 108.50 8.64 0.70 N 6 2 "C1'" B G 2 ? ? "O4'" B G 2 ? ? "C4'" B G 2 ? ? 103.02 109.70 -6.68 0.70 N 7 2 "O4'" B G 2 ? ? "C1'" B G 2 ? ? N9 B G 2 ? ? 113.97 108.50 5.47 0.70 N 8 2 "O4'" B G 4 ? ? "C1'" B G 4 ? ? N9 B G 4 ? ? 112.99 108.50 4.49 0.70 N 9 3 "C1'" B G 2 ? ? "O4'" B G 2 ? ? "C4'" B G 2 ? ? 105.31 109.70 -4.39 0.70 N 10 3 "O4'" B G 4 ? ? "C1'" B G 4 ? ? N9 B G 4 ? ? 113.10 108.50 4.60 0.70 N 11 4 CB A TYR 82 ? ? CG A TYR 82 ? ? CD2 A TYR 82 ? ? 116.70 121.00 -4.30 0.60 N 12 4 "O4'" B A 1 ? ? "C1'" B A 1 ? ? N9 B A 1 ? ? 115.44 108.50 6.94 0.70 N 13 4 "O4'" B G 4 ? ? "C1'" B G 4 ? ? N9 B G 4 ? ? 112.92 108.50 4.42 0.70 N 14 5 CB A TYR 82 ? ? CG A TYR 82 ? ? CD2 A TYR 82 ? ? 115.85 121.00 -5.15 0.60 N 15 5 CB A TYR 82 ? ? CG A TYR 82 ? ? CD1 A TYR 82 ? ? 124.61 121.00 3.61 0.60 N 16 5 "O4'" B G 2 ? ? "C1'" B G 2 ? ? N9 B G 2 ? ? 113.64 108.50 5.14 0.70 N 17 5 "O4'" B G 4 ? ? "C1'" B G 4 ? ? N9 B G 4 ? ? 112.97 108.50 4.47 0.70 N 18 6 CB A TYR 82 ? ? CG A TYR 82 ? ? CD2 A TYR 82 ? ? 116.19 121.00 -4.81 0.60 N 19 6 "C1'" B G 2 ? ? "O4'" B G 2 ? ? "C4'" B G 2 ? ? 105.45 109.70 -4.25 0.70 N 20 6 "O4'" B G 3 ? ? "C1'" B G 3 ? ? N9 B G 3 ? ? 113.81 108.50 5.31 0.70 N 21 6 "O4'" B U 6 ? ? "C1'" B U 6 ? ? N1 B U 6 ? ? 113.16 108.50 4.66 0.70 N 22 7 CB A TYR 82 ? ? CG A TYR 82 ? ? CD2 A TYR 82 ? ? 115.88 121.00 -5.12 0.60 N 23 7 "C1'" B G 2 ? ? "O4'" B G 2 ? ? "C4'" B G 2 ? ? 104.98 109.70 -4.72 0.70 N 24 7 "O4'" B G 2 ? ? "C1'" B G 2 ? ? N9 B G 2 ? ? 115.36 108.50 6.86 0.70 N 25 7 "O4'" B G 4 ? ? "C1'" B G 4 ? ? N9 B G 4 ? ? 114.99 108.50 6.49 0.70 N 26 7 "O4'" B A 5 ? ? "C1'" B A 5 ? ? N9 B A 5 ? ? 113.44 108.50 4.94 0.70 N 27 8 CB A TYR 82 ? ? CG A TYR 82 ? ? CD2 A TYR 82 ? ? 116.04 121.00 -4.96 0.60 N 28 8 "C1'" B A 1 ? ? "O4'" B A 1 ? ? "C4'" B A 1 ? ? 105.28 109.70 -4.42 0.70 N 29 8 "O4'" B A 1 ? ? "C1'" B A 1 ? ? "C2'" B A 1 ? ? 97.72 105.80 -8.08 1.00 N 30 8 "O4'" B A 1 ? ? "C1'" B A 1 ? ? N9 B A 1 ? ? 116.71 108.50 8.21 0.70 N 31 8 "C1'" B G 2 ? ? "O4'" B G 2 ? ? "C4'" B G 2 ? ? 103.43 109.70 -6.27 0.70 N 32 8 "O4'" B G 2 ? ? "C1'" B G 2 ? ? N9 B G 2 ? ? 114.53 108.50 6.03 0.70 N 33 8 "O4'" B G 3 ? ? "C1'" B G 3 ? ? N9 B G 3 ? ? 112.76 108.50 4.26 0.70 N 34 9 CB A TYR 82 ? ? CG A TYR 82 ? ? CD2 A TYR 82 ? ? 115.79 121.00 -5.21 0.60 N 35 9 "O4'" B G 4 ? ? "C1'" B G 4 ? ? N9 B G 4 ? ? 112.87 108.50 4.37 0.70 N 36 10 "O4'" B G 3 ? ? "C1'" B G 3 ? ? N9 B G 3 ? ? 112.89 108.50 4.39 0.70 N 37 10 "O4'" B U 6 ? ? "C1'" B U 6 ? ? N1 B U 6 ? ? 112.81 108.50 4.31 0.70 N 38 11 "C1'" B G 2 ? ? "O4'" B G 2 ? ? "C4'" B G 2 ? ? 102.14 109.70 -7.56 0.70 N 39 11 "O4'" B G 2 ? ? "C1'" B G 2 ? ? N9 B G 2 ? ? 116.10 108.50 7.60 0.70 N 40 11 "O4'" B G 4 ? ? "C1'" B G 4 ? ? N9 B G 4 ? ? 114.24 108.50 5.74 0.70 N 41 12 CB A TYR 82 ? ? CG A TYR 82 ? ? CD2 A TYR 82 ? ? 116.65 121.00 -4.35 0.60 N 42 12 "O4'" B G 3 ? ? "C1'" B G 3 ? ? N9 B G 3 ? ? 113.92 108.50 5.42 0.70 N 43 13 CB A TYR 82 ? ? CG A TYR 82 ? ? CD2 A TYR 82 ? ? 116.33 121.00 -4.67 0.60 N 44 14 CB A TYR 82 ? ? CG A TYR 82 ? ? CD2 A TYR 82 ? ? 115.70 121.00 -5.30 0.60 N 45 14 "C1'" B G 2 ? ? "O4'" B G 2 ? ? "C4'" B G 2 ? ? 104.70 109.70 -5.00 0.70 N 46 14 "O4'" B G 2 ? ? "C1'" B G 2 ? ? N9 B G 2 ? ? 115.04 108.50 6.54 0.70 N 47 14 "O4'" B G 3 ? ? "C1'" B G 3 ? ? N9 B G 3 ? ? 114.61 108.50 6.11 0.70 N 48 14 "O4'" B G 4 ? ? "C1'" B G 4 ? ? N9 B G 4 ? ? 113.23 108.50 4.73 0.70 N 49 14 "O4'" B U 6 ? ? "C1'" B U 6 ? ? N1 B U 6 ? ? 113.14 108.50 4.64 0.70 N 50 15 CB A TYR 82 ? ? CG A TYR 82 ? ? CD2 A TYR 82 ? ? 116.17 121.00 -4.83 0.60 N 51 15 "O4'" B G 2 ? ? "C1'" B G 2 ? ? N9 B G 2 ? ? 113.49 108.50 4.99 0.70 N 52 15 "O4'" B G 3 ? ? "C1'" B G 3 ? ? N9 B G 3 ? ? 114.04 108.50 5.54 0.70 N 53 15 "O4'" B G 4 ? ? "C1'" B G 4 ? ? N9 B G 4 ? ? 112.91 108.50 4.41 0.70 N 54 16 CB A TYR 82 ? ? CG A TYR 82 ? ? CD2 A TYR 82 ? ? 115.22 121.00 -5.78 0.60 N 55 16 CB A TYR 82 ? ? CG A TYR 82 ? ? CD1 A TYR 82 ? ? 125.12 121.00 4.12 0.60 N 56 16 "O4'" B G 3 ? ? "C1'" B G 3 ? ? N9 B G 3 ? ? 113.36 108.50 4.86 0.70 N 57 17 CB A TYR 82 ? ? CG A TYR 82 ? ? CD2 A TYR 82 ? ? 116.31 121.00 -4.69 0.60 N 58 18 "C3'" B A 1 ? ? "O3'" B A 1 ? ? P B G 2 ? ? 127.05 119.70 7.35 1.20 Y 59 18 "O4'" B G 2 ? ? "C1'" B G 2 ? ? N9 B G 2 ? ? 112.75 108.50 4.25 0.70 N 60 19 "C1'" B G 2 ? ? "O4'" B G 2 ? ? "C4'" B G 2 ? ? 105.35 109.70 -4.35 0.70 N 61 19 "O4'" B G 2 ? ? "C1'" B G 2 ? ? N9 B G 2 ? ? 114.65 108.50 6.15 0.70 N 62 19 "O4'" B A 5 ? ? "C1'" B A 5 ? ? N9 B A 5 ? ? 112.97 108.50 4.47 0.70 N 63 20 CB A TYR 82 ? ? CG A TYR 82 ? ? CD2 A TYR 82 ? ? 116.61 121.00 -4.39 0.60 N 64 20 "O4'" B G 2 ? ? "C1'" B G 2 ? ? N9 B G 2 ? ? 113.32 108.50 4.82 0.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 2 ? ? -144.63 15.56 2 1 LEU A 3 ? ? -143.67 17.98 3 1 GLU A 9 ? ? -145.37 16.02 4 1 PHE A 11 ? ? -87.85 48.32 5 1 LEU A 18 ? ? 66.62 174.29 6 1 PRO A 19 ? ? -51.61 177.69 7 1 LEU A 31 ? ? -100.67 52.20 8 1 SER A 32 ? ? -62.43 8.83 9 1 ILE A 36 ? ? -99.07 43.15 10 1 HIS A 37 ? ? 63.10 -42.58 11 1 ASP A 38 ? ? -148.58 -2.33 12 1 ALA A 40 ? ? -63.50 5.93 13 1 ASP A 74 ? ? -44.82 -14.07 14 1 ARG A 75 ? ? -148.02 21.96 15 1 GLU A 76 ? ? -71.10 -166.29 16 1 ARG A 90 ? ? 74.90 -25.43 17 2 GLU A 6 ? ? -141.38 11.46 18 2 GLU A 9 ? ? -141.56 10.68 19 2 LEU A 18 ? ? 71.13 160.96 20 2 PRO A 19 ? ? -71.54 30.66 21 2 LEU A 31 ? ? -103.40 45.39 22 2 ASP A 38 ? ? -152.28 9.61 23 2 ALA A 40 ? ? -64.00 2.48 24 2 GLU A 50 ? ? -149.62 18.08 25 2 GLN A 53 ? ? -75.56 37.31 26 2 SER A 54 ? ? -68.04 24.75 27 2 GLU A 56 ? ? -112.64 -154.02 28 2 ASP A 74 ? ? -47.14 -10.47 29 2 ARG A 75 ? ? -155.35 28.02 30 2 GLU A 76 ? ? -73.77 -160.53 31 2 HIS A 80 ? ? -154.47 4.28 32 2 HIS A 89 ? ? -148.06 13.12 33 2 ARG A 90 ? ? 73.98 -25.83 34 2 HIS A 99 ? ? 145.43 -45.85 35 2 SER A 100 ? ? -168.25 -7.74 36 3 GLU A 9 ? ? -142.64 14.18 37 3 PHE A 11 ? ? -90.77 52.93 38 3 LEU A 18 ? ? 70.41 159.07 39 3 PRO A 19 ? ? -56.21 -179.17 40 3 TRP A 20 ? ? -59.62 -8.94 41 3 ASP A 33 ? ? 56.47 -3.39 42 3 ILE A 36 ? ? -110.00 41.97 43 3 HIS A 37 ? ? 61.14 -27.34 44 3 ASP A 38 ? ? -157.80 -27.23 45 3 ALA A 40 ? ? 51.99 10.80 46 3 ALA A 41 ? ? -143.13 16.99 47 3 GLU A 50 ? ? -166.84 95.42 48 3 SER A 54 ? ? 36.34 49.08 49 3 ASP A 74 ? ? -45.41 -11.96 50 3 ARG A 75 ? ? -150.80 23.93 51 3 GLU A 76 ? ? -69.39 -164.53 52 3 HIS A 80 ? ? -142.18 -2.61 53 3 HIS A 89 ? ? -152.29 17.17 54 3 ARG A 90 ? ? 74.30 -32.66 55 3 HIS A 99 ? ? -141.39 11.23 56 4 GLU A 9 ? ? -145.33 12.77 57 4 LEU A 18 ? ? 59.08 154.69 58 4 PRO A 19 ? ? -48.56 86.43 59 4 TRP A 20 ? ? 50.79 4.57 60 4 SER A 32 ? ? -64.72 9.72 61 4 HIS A 37 ? ? 60.62 -19.93 62 4 ASP A 38 ? ? -155.24 -36.97 63 4 ALA A 40 ? ? -145.69 11.28 64 4 GLU A 50 ? ? -160.65 38.72 65 4 ARG A 52 ? ? -141.22 11.17 66 4 GLN A 53 ? ? 57.96 -5.33 67 4 ASP A 74 ? ? -48.44 -0.46 68 4 ARG A 75 ? ? -151.65 11.84 69 4 GLU A 76 ? ? -71.99 -163.50 70 4 HIS A 80 ? ? -143.92 -9.01 71 4 HIS A 89 ? ? -149.29 12.09 72 4 ARG A 90 ? ? 76.48 -29.42 73 4 HIS A 99 ? ? -150.21 12.66 74 5 MET A 2 ? ? -155.57 6.68 75 5 GLU A 9 ? ? -140.21 21.15 76 5 PHE A 11 ? ? -86.39 44.41 77 5 LEU A 18 ? ? 38.82 95.31 78 5 ASP A 33 ? ? 56.58 -5.94 79 5 ASP A 38 ? ? -146.62 -15.16 80 5 ALA A 40 ? ? -179.90 0.07 81 5 ARG A 52 ? ? -147.45 27.45 82 5 GLN A 53 ? ? 53.87 -171.17 83 5 ASP A 74 ? ? -46.92 -10.82 84 5 ARG A 75 ? ? -152.67 29.31 85 5 GLU A 76 ? ? -65.30 -166.44 86 5 MET A 78 ? ? 52.04 3.57 87 5 ARG A 81 ? ? -143.60 -129.22 88 5 ARG A 90 ? ? 76.71 -24.48 89 5 HIS A 99 ? ? -142.53 19.86 90 6 MET A 2 ? ? -151.41 20.26 91 6 PRO A 5 ? ? -53.48 14.76 92 6 GLU A 9 ? ? -145.56 19.87 93 6 PHE A 11 ? ? -88.10 44.63 94 6 LEU A 18 ? ? 62.08 173.17 95 6 PRO A 19 ? ? -46.62 173.92 96 6 TRP A 20 ? ? -58.99 -1.90 97 6 ASP A 33 ? ? 58.49 -5.73 98 6 HIS A 37 ? ? 63.12 -42.91 99 6 ASP A 38 ? ? -148.89 -2.07 100 6 ALA A 40 ? ? -63.20 5.81 101 6 GLU A 56 ? ? 50.57 -137.19 102 6 ASP A 74 ? ? -44.44 -19.87 103 6 HIS A 80 ? ? -148.05 -11.20 104 6 ARG A 90 ? ? 77.58 -25.28 105 7 LEU A 18 ? ? 87.76 159.29 106 7 PRO A 19 ? ? -54.88 40.44 107 7 LEU A 31 ? ? -100.46 61.89 108 7 ASP A 33 ? ? 60.02 -6.03 109 7 HIS A 37 ? ? 59.44 -18.28 110 7 ASP A 38 ? ? -153.43 -28.39 111 7 ALA A 40 ? ? -177.65 4.86 112 7 ASP A 74 ? ? -52.15 -7.40 113 7 ARG A 75 ? ? -158.96 28.48 114 7 GLU A 76 ? ? -73.03 -156.42 115 7 HIS A 80 ? ? -151.86 -7.64 116 7 HIS A 89 ? ? -147.68 -10.67 117 7 ARG A 90 ? ? 103.41 -27.45 118 7 HIS A 99 ? ? -142.77 24.12 119 8 GLU A 9 ? ? -149.29 12.76 120 8 LEU A 18 ? ? 61.76 156.55 121 8 PRO A 19 ? ? -67.90 72.60 122 8 LEU A 31 ? ? -95.85 52.23 123 8 SER A 32 ? ? -62.32 9.02 124 8 ILE A 36 ? ? -89.16 41.49 125 8 HIS A 37 ? ? 62.96 -39.66 126 8 ASP A 38 ? ? -149.49 -8.71 127 8 ALA A 40 ? ? -62.88 4.00 128 8 GLU A 50 ? ? -147.85 17.84 129 8 ARG A 52 ? ? -156.25 7.97 130 8 SER A 54 ? ? -65.36 60.38 131 8 ASP A 74 ? ? -47.20 -6.63 132 8 ARG A 75 ? ? -155.81 27.55 133 8 GLU A 76 ? ? -73.41 -157.55 134 8 HIS A 80 ? ? -145.27 -8.47 135 8 HIS A 89 ? ? -147.68 12.66 136 8 ARG A 90 ? ? 75.43 -26.25 137 8 HIS A 99 ? ? -146.11 28.24 138 9 LEU A 18 ? ? 61.33 150.63 139 9 TRP A 20 ? ? -159.29 -8.22 140 9 ASP A 33 ? ? 62.75 -14.48 141 9 HIS A 37 ? ? 63.78 -29.00 142 9 ASP A 38 ? ? -158.25 -26.97 143 9 ALA A 40 ? ? 52.34 9.62 144 9 ALA A 41 ? ? -143.58 18.05 145 9 ARG A 52 ? ? -172.87 -21.73 146 9 GLN A 53 ? ? 46.69 -139.59 147 9 SER A 54 ? ? -144.76 24.14 148 9 GLU A 56 ? ? -129.69 -135.33 149 9 ASP A 74 ? ? -46.65 -11.12 150 9 ARG A 75 ? ? -155.82 29.02 151 9 GLU A 76 ? ? -74.27 -158.37 152 9 HIS A 80 ? ? -151.30 -7.99 153 9 ARG A 90 ? ? 75.59 -25.96 154 9 HIS A 99 ? ? -148.89 21.02 155 10 GLU A 6 ? ? -142.71 11.67 156 10 GLU A 9 ? ? -140.86 12.49 157 10 PHE A 11 ? ? -97.72 57.05 158 10 LEU A 18 ? ? 70.05 165.72 159 10 TRP A 20 ? ? 164.69 -30.49 160 10 ASP A 33 ? ? 52.49 7.62 161 10 ILE A 36 ? ? 43.82 24.32 162 10 HIS A 37 ? ? 63.26 -36.25 163 10 ASP A 38 ? ? -152.45 -2.36 164 10 ALA A 40 ? ? -60.17 0.10 165 10 THR A 48 ? ? -152.47 -33.23 166 10 ARG A 49 ? ? -171.33 -175.55 167 10 GLU A 50 ? ? -69.39 63.36 168 10 SER A 54 ? ? 44.32 26.06 169 10 ASP A 74 ? ? -44.57 -11.90 170 10 ARG A 75 ? ? -149.39 22.13 171 10 GLU A 76 ? ? -69.58 -168.21 172 10 HIS A 89 ? ? -153.05 15.06 173 10 ARG A 90 ? ? 74.70 -34.52 174 11 MET A 2 ? ? 56.51 179.57 175 11 LEU A 3 ? ? -151.82 -14.06 176 11 GLU A 6 ? ? -140.69 10.48 177 11 GLU A 9 ? ? 53.73 18.80 178 11 LEU A 18 ? ? 70.18 172.87 179 11 PRO A 19 ? ? -56.83 28.43 180 11 LEU A 31 ? ? -102.51 62.11 181 11 ASP A 33 ? ? 57.86 -1.59 182 11 HIS A 37 ? ? 67.36 -42.93 183 11 ASP A 38 ? ? -152.56 1.72 184 11 ALA A 40 ? ? -62.82 5.40 185 11 ARG A 49 ? ? -66.60 5.03 186 11 GLN A 53 ? ? 55.25 19.24 187 11 LEU A 61 ? ? -126.57 -167.03 188 11 ASP A 74 ? ? -49.20 -12.94 189 11 ARG A 75 ? ? -159.57 34.16 190 11 HIS A 80 ? ? -147.00 -17.69 191 11 HIS A 89 ? ? -143.01 13.85 192 11 ARG A 90 ? ? 74.34 -33.15 193 12 LEU A 3 ? ? -145.65 15.12 194 12 GLU A 9 ? ? -84.72 33.78 195 12 PHE A 11 ? ? -91.17 50.65 196 12 LEU A 18 ? ? 60.75 151.30 197 12 PRO A 19 ? ? -63.81 89.93 198 12 TRP A 20 ? ? 56.59 0.37 199 12 LEU A 31 ? ? -91.95 53.57 200 12 SER A 32 ? ? -64.68 9.13 201 12 ILE A 36 ? ? -85.15 42.26 202 12 HIS A 37 ? ? 60.19 -19.28 203 12 ASP A 38 ? ? -155.38 -37.22 204 12 ALA A 40 ? ? -143.09 12.31 205 12 GLN A 53 ? ? -64.91 7.92 206 12 GLU A 56 ? ? 80.55 -165.89 207 12 ASP A 74 ? ? -44.60 -12.50 208 12 ARG A 75 ? ? -145.81 16.37 209 12 GLU A 76 ? ? -71.61 -161.27 210 12 HIS A 80 ? ? -144.03 -4.58 211 12 HIS A 89 ? ? -140.19 -44.20 212 12 ARG A 90 ? ? 131.19 -21.86 213 12 HIS A 99 ? ? -141.79 22.76 214 13 GLU A 9 ? ? -154.41 -1.57 215 13 LEU A 18 ? ? 60.07 162.24 216 13 PRO A 19 ? ? -50.73 75.53 217 13 TRP A 20 ? ? 52.61 6.00 218 13 LEU A 31 ? ? -104.18 53.73 219 13 SER A 32 ? ? -63.35 9.83 220 13 HIS A 37 ? ? 63.03 -18.69 221 13 ASP A 38 ? ? -157.14 -37.41 222 13 ALA A 40 ? ? -147.42 11.48 223 13 ARG A 49 ? ? 38.25 31.15 224 13 GLU A 50 ? ? 38.15 42.98 225 13 SER A 54 ? ? 46.38 14.89 226 13 GLU A 56 ? ? 49.73 -135.01 227 13 ASP A 74 ? ? -48.17 -5.45 228 13 ARG A 75 ? ? -155.13 25.24 229 13 GLU A 76 ? ? -72.04 -162.15 230 13 HIS A 80 ? ? -149.66 -16.68 231 13 HIS A 89 ? ? -150.32 13.07 232 13 ARG A 90 ? ? 79.38 -28.07 233 14 MET A 2 ? ? 55.91 178.78 234 14 PHE A 11 ? ? 49.78 26.05 235 14 LEU A 18 ? ? 63.38 156.08 236 14 PRO A 19 ? ? -67.79 69.57 237 14 TRP A 20 ? ? 47.81 24.94 238 14 LEU A 31 ? ? -102.85 63.67 239 14 ASP A 33 ? ? 59.11 -3.88 240 14 ILE A 36 ? ? -99.69 43.29 241 14 HIS A 37 ? ? 62.33 -27.98 242 14 ASP A 38 ? ? -157.13 -25.31 243 14 ALA A 40 ? ? 51.63 12.04 244 14 ALA A 41 ? ? -142.35 16.77 245 14 GLU A 50 ? ? -146.54 32.74 246 14 ASP A 74 ? ? -50.56 -7.29 247 14 ARG A 75 ? ? -155.97 24.04 248 14 GLU A 76 ? ? -73.90 -158.77 249 14 HIS A 80 ? ? -145.33 -6.44 250 14 HIS A 89 ? ? -148.04 12.90 251 14 ARG A 90 ? ? 78.82 -27.91 252 15 GLU A 6 ? ? -140.73 12.01 253 15 GLU A 9 ? ? 49.75 91.52 254 15 PHE A 11 ? ? -84.00 47.09 255 15 LEU A 18 ? ? 59.21 167.80 256 15 SER A 21 ? ? -155.56 17.67 257 15 SER A 32 ? ? -62.43 7.40 258 15 ASP A 38 ? ? -150.67 1.70 259 15 ALA A 40 ? ? -64.13 1.94 260 15 GLU A 50 ? ? -168.38 105.57 261 15 SER A 54 ? ? 34.99 56.18 262 15 ASP A 74 ? ? -48.76 -14.34 263 15 ARG A 75 ? ? -157.33 15.53 264 15 GLU A 76 ? ? -78.83 -161.08 265 15 HIS A 80 ? ? -151.31 -11.66 266 15 HIS A 89 ? ? -144.19 12.56 267 15 ARG A 90 ? ? 74.35 -26.63 268 15 HIS A 99 ? ? -144.92 22.30 269 16 MET A 2 ? ? -149.52 -0.62 270 16 GLU A 9 ? ? 65.81 -27.00 271 16 LEU A 18 ? ? 59.69 148.36 272 16 PRO A 19 ? ? -65.35 98.52 273 16 TRP A 20 ? ? 48.69 9.16 274 16 LEU A 31 ? ? -102.99 60.30 275 16 SER A 32 ? ? -57.93 5.65 276 16 ILE A 36 ? ? -83.39 41.51 277 16 HIS A 37 ? ? 60.16 -18.65 278 16 ASP A 38 ? ? -155.41 -37.41 279 16 ALA A 40 ? ? -141.70 12.20 280 16 SER A 54 ? ? 128.19 144.27 281 16 GLU A 56 ? ? -136.74 -152.41 282 16 ASP A 74 ? ? -46.38 -10.37 283 16 ARG A 75 ? ? -151.46 18.95 284 16 GLU A 76 ? ? -71.70 -161.51 285 16 HIS A 80 ? ? -153.48 -3.85 286 16 HIS A 89 ? ? -155.35 16.53 287 16 ARG A 90 ? ? 76.52 -28.82 288 16 HIS A 99 ? ? -151.34 -4.53 289 16 SER A 100 ? ? 52.59 11.99 290 17 GLU A 9 ? ? -146.33 16.45 291 17 PHE A 11 ? ? -82.56 42.49 292 17 LEU A 18 ? ? 61.33 162.02 293 17 PRO A 19 ? ? -50.34 79.16 294 17 TRP A 20 ? ? 53.69 0.45 295 17 ASP A 33 ? ? 60.33 -10.08 296 17 ASP A 38 ? ? -153.16 9.79 297 17 ALA A 40 ? ? -64.14 3.14 298 17 SER A 54 ? ? -46.95 155.90 299 17 ASP A 74 ? ? -45.11 -12.81 300 17 ARG A 75 ? ? -148.67 25.13 301 17 GLU A 76 ? ? -63.36 -168.77 302 17 MET A 78 ? ? 53.08 10.93 303 17 HIS A 80 ? ? -144.10 -11.00 304 17 ARG A 81 ? ? -154.44 -122.67 305 17 TYR A 82 ? ? -162.88 117.51 306 17 HIS A 89 ? ? -141.84 -44.10 307 17 ARG A 90 ? ? 133.04 -22.30 308 18 MET A 2 ? ? 53.51 15.84 309 18 LEU A 3 ? ? -154.07 -19.19 310 18 GLU A 6 ? ? -141.81 10.10 311 18 PHE A 11 ? ? -88.72 45.35 312 18 LEU A 18 ? ? 62.91 165.83 313 18 PRO A 19 ? ? -51.60 60.02 314 18 TRP A 20 ? ? 58.56 9.24 315 18 LEU A 31 ? ? -109.41 52.38 316 18 SER A 32 ? ? -62.77 7.80 317 18 HIS A 37 ? ? 61.93 -19.79 318 18 ASP A 38 ? ? -155.15 -28.13 319 18 ALA A 40 ? ? -173.33 3.31 320 18 GLU A 50 ? ? -145.94 23.16 321 18 SER A 54 ? ? -141.83 20.07 322 18 GLU A 56 ? ? 51.33 -137.78 323 18 ASP A 74 ? ? -48.09 -5.63 324 18 ARG A 75 ? ? -152.41 20.42 325 18 GLU A 76 ? ? -70.76 -162.60 326 18 HIS A 80 ? ? -147.33 -20.92 327 18 HIS A 89 ? ? -145.29 -39.19 328 18 ARG A 90 ? ? 126.38 -22.93 329 18 HIS A 99 ? ? -149.79 36.87 330 19 MET A 2 ? ? 52.83 7.84 331 19 GLU A 9 ? ? -149.54 12.16 332 19 LEU A 18 ? ? 63.43 162.65 333 19 PRO A 19 ? ? -51.28 63.70 334 19 TRP A 20 ? ? 55.58 8.29 335 19 LEU A 31 ? ? -106.44 50.43 336 19 SER A 32 ? ? -64.79 20.89 337 19 CYS A 34 ? ? -122.35 -166.14 338 19 HIS A 37 ? ? 62.17 -26.92 339 19 ASP A 38 ? ? -159.30 -22.93 340 19 ALA A 40 ? ? 51.80 11.91 341 19 ALA A 41 ? ? -143.66 16.31 342 19 TYR A 47 ? ? -63.69 -173.51 343 19 GLU A 50 ? ? -147.57 17.46 344 19 ARG A 52 ? ? -147.67 -68.37 345 19 SER A 54 ? ? -161.78 9.56 346 19 GLU A 56 ? ? 62.05 -117.61 347 19 ASP A 74 ? ? -45.21 -17.20 348 19 ARG A 75 ? ? -140.85 21.85 349 19 GLU A 76 ? ? -69.69 -168.20 350 19 MET A 78 ? ? -131.38 -31.07 351 19 HIS A 80 ? ? 51.97 -1.27 352 19 ARG A 90 ? ? 81.14 -28.33 353 19 HIS A 99 ? ? -143.80 14.14 354 20 MET A 2 ? ? -145.74 -6.49 355 20 LEU A 3 ? ? 45.63 23.84 356 20 GLU A 9 ? ? -155.13 -3.51 357 20 LEU A 18 ? ? 69.42 164.45 358 20 PRO A 19 ? ? -47.87 -167.84 359 20 TRP A 20 ? ? -59.33 1.01 360 20 ASP A 33 ? ? 59.18 -7.98 361 20 HIS A 37 ? ? 63.62 -41.77 362 20 ASP A 38 ? ? -151.61 -7.70 363 20 ALA A 40 ? ? -62.71 4.42 364 20 GLU A 50 ? ? -144.78 35.33 365 20 ARG A 52 ? ? 81.33 11.61 366 20 SER A 54 ? ? -59.15 2.33 367 20 LEU A 61 ? ? -125.17 -163.97 368 20 ASP A 74 ? ? -48.20 -9.84 369 20 ARG A 75 ? ? -162.29 21.66 370 20 GLU A 76 ? ? -72.67 -164.24 371 20 MET A 78 ? ? 64.11 -24.97 372 20 ARG A 81 ? ? -147.58 -132.37 373 20 HIS A 89 ? ? -154.09 18.96 374 20 ARG A 90 ? ? 70.23 -35.49 375 20 LYS A 98 ? ? -71.28 26.94 376 20 SER A 100 ? ? 57.27 179.96 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 G B 2 ? ? 0.082 'SIDE CHAIN' 2 4 G B 3 ? ? 0.062 'SIDE CHAIN' 3 6 G B 3 ? ? 0.073 'SIDE CHAIN' 4 7 G B 2 ? ? 0.053 'SIDE CHAIN' 5 8 A B 5 ? ? 0.061 'SIDE CHAIN' 6 12 G B 3 ? ? 0.070 'SIDE CHAIN' 7 13 A B 5 ? ? 0.071 'SIDE CHAIN' 8 14 G B 3 ? ? 0.090 'SIDE CHAIN' 9 15 G B 3 ? ? 0.075 'SIDE CHAIN' 10 18 A B 5 ? ? 0.067 'SIDE CHAIN' 11 20 G B 2 ? ? 0.075 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -33 ? A MET 1 2 1 Y 1 A GLY -32 ? A GLY 2 3 1 Y 1 A SER -31 ? A SER 3 4 1 Y 1 A SER -30 ? A SER 4 5 1 Y 1 A HIS -29 ? A HIS 5 6 1 Y 1 A HIS -28 ? A HIS 6 7 1 Y 1 A HIS -27 ? A HIS 7 8 1 Y 1 A HIS -26 ? A HIS 8 9 1 Y 1 A HIS -25 ? A HIS 9 10 1 Y 1 A HIS -24 ? A HIS 10 11 1 Y 1 A SER -23 ? A SER 11 12 1 Y 1 A SER -22 ? A SER 12 13 1 Y 1 A GLY -21 ? A GLY 13 14 1 Y 1 A LEU -20 ? A LEU 14 15 1 Y 1 A VAL -19 ? A VAL 15 16 1 Y 1 A PRO -18 ? A PRO 16 17 1 Y 1 A ARG -17 ? A ARG 17 18 1 Y 1 A GLY -16 ? A GLY 18 19 1 Y 1 A SER -15 ? A SER 19 20 1 Y 1 A HIS -14 ? A HIS 20 21 1 Y 1 A MET -13 ? A MET 21 22 1 Y 1 A ALA -12 ? A ALA 22 23 1 Y 1 A SER -11 ? A SER 23 24 1 Y 1 A MET -10 ? A MET 24 25 1 Y 1 A THR -9 ? A THR 25 26 1 Y 1 A GLY -8 ? A GLY 26 27 1 Y 1 A GLY -7 ? A GLY 27 28 1 Y 1 A GLN -6 ? A GLN 28 29 1 Y 1 A GLN -5 ? A GLN 29 30 1 Y 1 A MET -4 ? A MET 30 31 1 Y 1 A GLY -3 ? A GLY 31 32 1 Y 1 A ARG -2 ? A ARG 32 33 1 Y 1 A GLY -1 ? A GLY 33 34 1 Y 1 A SER 0 ? A SER 34 35 2 Y 1 A MET -33 ? A MET 1 36 2 Y 1 A GLY -32 ? A GLY 2 37 2 Y 1 A SER -31 ? A SER 3 38 2 Y 1 A SER -30 ? A SER 4 39 2 Y 1 A HIS -29 ? A HIS 5 40 2 Y 1 A HIS -28 ? A HIS 6 41 2 Y 1 A HIS -27 ? A HIS 7 42 2 Y 1 A HIS -26 ? A HIS 8 43 2 Y 1 A HIS -25 ? A HIS 9 44 2 Y 1 A HIS -24 ? A HIS 10 45 2 Y 1 A SER -23 ? A SER 11 46 2 Y 1 A SER -22 ? A SER 12 47 2 Y 1 A GLY -21 ? A GLY 13 48 2 Y 1 A LEU -20 ? A LEU 14 49 2 Y 1 A VAL -19 ? A VAL 15 50 2 Y 1 A PRO -18 ? A PRO 16 51 2 Y 1 A ARG -17 ? A ARG 17 52 2 Y 1 A GLY -16 ? A GLY 18 53 2 Y 1 A SER -15 ? A SER 19 54 2 Y 1 A HIS -14 ? A HIS 20 55 2 Y 1 A MET -13 ? A MET 21 56 2 Y 1 A ALA -12 ? A ALA 22 57 2 Y 1 A SER -11 ? A SER 23 58 2 Y 1 A MET -10 ? A MET 24 59 2 Y 1 A THR -9 ? A THR 25 60 2 Y 1 A GLY -8 ? A GLY 26 61 2 Y 1 A GLY -7 ? A GLY 27 62 2 Y 1 A GLN -6 ? A GLN 28 63 2 Y 1 A GLN -5 ? A GLN 29 64 2 Y 1 A MET -4 ? A MET 30 65 2 Y 1 A GLY -3 ? A GLY 31 66 2 Y 1 A ARG -2 ? A ARG 32 67 2 Y 1 A GLY -1 ? A GLY 33 68 2 Y 1 A SER 0 ? A SER 34 69 3 Y 1 A MET -33 ? A MET 1 70 3 Y 1 A GLY -32 ? A GLY 2 71 3 Y 1 A SER -31 ? A SER 3 72 3 Y 1 A SER -30 ? A SER 4 73 3 Y 1 A HIS -29 ? A HIS 5 74 3 Y 1 A HIS -28 ? A HIS 6 75 3 Y 1 A HIS -27 ? A HIS 7 76 3 Y 1 A HIS -26 ? A HIS 8 77 3 Y 1 A HIS -25 ? A HIS 9 78 3 Y 1 A HIS -24 ? A HIS 10 79 3 Y 1 A SER -23 ? A SER 11 80 3 Y 1 A SER -22 ? A SER 12 81 3 Y 1 A GLY -21 ? A GLY 13 82 3 Y 1 A LEU -20 ? A LEU 14 83 3 Y 1 A VAL -19 ? A VAL 15 84 3 Y 1 A PRO -18 ? A PRO 16 85 3 Y 1 A ARG -17 ? A ARG 17 86 3 Y 1 A GLY -16 ? A GLY 18 87 3 Y 1 A SER -15 ? A SER 19 88 3 Y 1 A HIS -14 ? A HIS 20 89 3 Y 1 A MET -13 ? A MET 21 90 3 Y 1 A ALA -12 ? A ALA 22 91 3 Y 1 A SER -11 ? A SER 23 92 3 Y 1 A MET -10 ? A MET 24 93 3 Y 1 A THR -9 ? A THR 25 94 3 Y 1 A GLY -8 ? A GLY 26 95 3 Y 1 A GLY -7 ? A GLY 27 96 3 Y 1 A GLN -6 ? A GLN 28 97 3 Y 1 A GLN -5 ? A GLN 29 98 3 Y 1 A MET -4 ? A MET 30 99 3 Y 1 A GLY -3 ? A GLY 31 100 3 Y 1 A ARG -2 ? A ARG 32 101 3 Y 1 A GLY -1 ? A GLY 33 102 3 Y 1 A SER 0 ? A SER 34 103 4 Y 1 A MET -33 ? A MET 1 104 4 Y 1 A GLY -32 ? A GLY 2 105 4 Y 1 A SER -31 ? A SER 3 106 4 Y 1 A SER -30 ? A SER 4 107 4 Y 1 A HIS -29 ? A HIS 5 108 4 Y 1 A HIS -28 ? A HIS 6 109 4 Y 1 A HIS -27 ? A HIS 7 110 4 Y 1 A HIS -26 ? A HIS 8 111 4 Y 1 A HIS -25 ? A HIS 9 112 4 Y 1 A HIS -24 ? A HIS 10 113 4 Y 1 A SER -23 ? A SER 11 114 4 Y 1 A SER -22 ? A SER 12 115 4 Y 1 A GLY -21 ? A GLY 13 116 4 Y 1 A LEU -20 ? A LEU 14 117 4 Y 1 A VAL -19 ? A VAL 15 118 4 Y 1 A PRO -18 ? A PRO 16 119 4 Y 1 A ARG -17 ? A ARG 17 120 4 Y 1 A GLY -16 ? A GLY 18 121 4 Y 1 A SER -15 ? A SER 19 122 4 Y 1 A HIS -14 ? A HIS 20 123 4 Y 1 A MET -13 ? A MET 21 124 4 Y 1 A ALA -12 ? A ALA 22 125 4 Y 1 A SER -11 ? A SER 23 126 4 Y 1 A MET -10 ? A MET 24 127 4 Y 1 A THR -9 ? A THR 25 128 4 Y 1 A GLY -8 ? A GLY 26 129 4 Y 1 A GLY -7 ? A GLY 27 130 4 Y 1 A GLN -6 ? A GLN 28 131 4 Y 1 A GLN -5 ? A GLN 29 132 4 Y 1 A MET -4 ? A MET 30 133 4 Y 1 A GLY -3 ? A GLY 31 134 4 Y 1 A ARG -2 ? A ARG 32 135 4 Y 1 A GLY -1 ? A GLY 33 136 4 Y 1 A SER 0 ? A SER 34 137 5 Y 1 A MET -33 ? A MET 1 138 5 Y 1 A GLY -32 ? A GLY 2 139 5 Y 1 A SER -31 ? A SER 3 140 5 Y 1 A SER -30 ? A SER 4 141 5 Y 1 A HIS -29 ? A HIS 5 142 5 Y 1 A HIS -28 ? A HIS 6 143 5 Y 1 A HIS -27 ? A HIS 7 144 5 Y 1 A HIS -26 ? A HIS 8 145 5 Y 1 A HIS -25 ? A HIS 9 146 5 Y 1 A HIS -24 ? A HIS 10 147 5 Y 1 A SER -23 ? A SER 11 148 5 Y 1 A SER -22 ? A SER 12 149 5 Y 1 A GLY -21 ? A GLY 13 150 5 Y 1 A LEU -20 ? A LEU 14 151 5 Y 1 A VAL -19 ? A VAL 15 152 5 Y 1 A PRO -18 ? A PRO 16 153 5 Y 1 A ARG -17 ? A ARG 17 154 5 Y 1 A GLY -16 ? A GLY 18 155 5 Y 1 A SER -15 ? A SER 19 156 5 Y 1 A HIS -14 ? A HIS 20 157 5 Y 1 A MET -13 ? A MET 21 158 5 Y 1 A ALA -12 ? A ALA 22 159 5 Y 1 A SER -11 ? A SER 23 160 5 Y 1 A MET -10 ? A MET 24 161 5 Y 1 A THR -9 ? A THR 25 162 5 Y 1 A GLY -8 ? A GLY 26 163 5 Y 1 A GLY -7 ? A GLY 27 164 5 Y 1 A GLN -6 ? A GLN 28 165 5 Y 1 A GLN -5 ? A GLN 29 166 5 Y 1 A MET -4 ? A MET 30 167 5 Y 1 A GLY -3 ? A GLY 31 168 5 Y 1 A ARG -2 ? A ARG 32 169 5 Y 1 A GLY -1 ? A GLY 33 170 5 Y 1 A SER 0 ? A SER 34 171 6 Y 1 A MET -33 ? A MET 1 172 6 Y 1 A GLY -32 ? A GLY 2 173 6 Y 1 A SER -31 ? A SER 3 174 6 Y 1 A SER -30 ? A SER 4 175 6 Y 1 A HIS -29 ? A HIS 5 176 6 Y 1 A HIS -28 ? A HIS 6 177 6 Y 1 A HIS -27 ? A HIS 7 178 6 Y 1 A HIS -26 ? A HIS 8 179 6 Y 1 A HIS -25 ? A HIS 9 180 6 Y 1 A HIS -24 ? A HIS 10 181 6 Y 1 A SER -23 ? A SER 11 182 6 Y 1 A SER -22 ? A SER 12 183 6 Y 1 A GLY -21 ? A GLY 13 184 6 Y 1 A LEU -20 ? A LEU 14 185 6 Y 1 A VAL -19 ? A VAL 15 186 6 Y 1 A PRO -18 ? A PRO 16 187 6 Y 1 A ARG -17 ? A ARG 17 188 6 Y 1 A GLY -16 ? A GLY 18 189 6 Y 1 A SER -15 ? A SER 19 190 6 Y 1 A HIS -14 ? A HIS 20 191 6 Y 1 A MET -13 ? A MET 21 192 6 Y 1 A ALA -12 ? A ALA 22 193 6 Y 1 A SER -11 ? A SER 23 194 6 Y 1 A MET -10 ? A MET 24 195 6 Y 1 A THR -9 ? A THR 25 196 6 Y 1 A GLY -8 ? A GLY 26 197 6 Y 1 A GLY -7 ? A GLY 27 198 6 Y 1 A GLN -6 ? A GLN 28 199 6 Y 1 A GLN -5 ? A GLN 29 200 6 Y 1 A MET -4 ? A MET 30 201 6 Y 1 A GLY -3 ? A GLY 31 202 6 Y 1 A ARG -2 ? A ARG 32 203 6 Y 1 A GLY -1 ? A GLY 33 204 6 Y 1 A SER 0 ? A SER 34 205 7 Y 1 A MET -33 ? A MET 1 206 7 Y 1 A GLY -32 ? A GLY 2 207 7 Y 1 A SER -31 ? A SER 3 208 7 Y 1 A SER -30 ? A SER 4 209 7 Y 1 A HIS -29 ? A HIS 5 210 7 Y 1 A HIS -28 ? A HIS 6 211 7 Y 1 A HIS -27 ? A HIS 7 212 7 Y 1 A HIS -26 ? A HIS 8 213 7 Y 1 A HIS -25 ? A HIS 9 214 7 Y 1 A HIS -24 ? A HIS 10 215 7 Y 1 A SER -23 ? A SER 11 216 7 Y 1 A SER -22 ? A SER 12 217 7 Y 1 A GLY -21 ? A GLY 13 218 7 Y 1 A LEU -20 ? A LEU 14 219 7 Y 1 A VAL -19 ? A VAL 15 220 7 Y 1 A PRO -18 ? A PRO 16 221 7 Y 1 A ARG -17 ? A ARG 17 222 7 Y 1 A GLY -16 ? A GLY 18 223 7 Y 1 A SER -15 ? A SER 19 224 7 Y 1 A HIS -14 ? A HIS 20 225 7 Y 1 A MET -13 ? A MET 21 226 7 Y 1 A ALA -12 ? A ALA 22 227 7 Y 1 A SER -11 ? A SER 23 228 7 Y 1 A MET -10 ? A MET 24 229 7 Y 1 A THR -9 ? A THR 25 230 7 Y 1 A GLY -8 ? A GLY 26 231 7 Y 1 A GLY -7 ? A GLY 27 232 7 Y 1 A GLN -6 ? A GLN 28 233 7 Y 1 A GLN -5 ? A GLN 29 234 7 Y 1 A MET -4 ? A MET 30 235 7 Y 1 A GLY -3 ? A GLY 31 236 7 Y 1 A ARG -2 ? A ARG 32 237 7 Y 1 A GLY -1 ? A GLY 33 238 7 Y 1 A SER 0 ? A SER 34 239 8 Y 1 A MET -33 ? A MET 1 240 8 Y 1 A GLY -32 ? A GLY 2 241 8 Y 1 A SER -31 ? A SER 3 242 8 Y 1 A SER -30 ? A SER 4 243 8 Y 1 A HIS -29 ? A HIS 5 244 8 Y 1 A HIS -28 ? A HIS 6 245 8 Y 1 A HIS -27 ? A HIS 7 246 8 Y 1 A HIS -26 ? A HIS 8 247 8 Y 1 A HIS -25 ? A HIS 9 248 8 Y 1 A HIS -24 ? A HIS 10 249 8 Y 1 A SER -23 ? A SER 11 250 8 Y 1 A SER -22 ? A SER 12 251 8 Y 1 A GLY -21 ? A GLY 13 252 8 Y 1 A LEU -20 ? A LEU 14 253 8 Y 1 A VAL -19 ? A VAL 15 254 8 Y 1 A PRO -18 ? A PRO 16 255 8 Y 1 A ARG -17 ? A ARG 17 256 8 Y 1 A GLY -16 ? A GLY 18 257 8 Y 1 A SER -15 ? A SER 19 258 8 Y 1 A HIS -14 ? A HIS 20 259 8 Y 1 A MET -13 ? A MET 21 260 8 Y 1 A ALA -12 ? A ALA 22 261 8 Y 1 A SER -11 ? A SER 23 262 8 Y 1 A MET -10 ? A MET 24 263 8 Y 1 A THR -9 ? A THR 25 264 8 Y 1 A GLY -8 ? A GLY 26 265 8 Y 1 A GLY -7 ? A GLY 27 266 8 Y 1 A GLN -6 ? A GLN 28 267 8 Y 1 A GLN -5 ? A GLN 29 268 8 Y 1 A MET -4 ? A MET 30 269 8 Y 1 A GLY -3 ? A GLY 31 270 8 Y 1 A ARG -2 ? A ARG 32 271 8 Y 1 A GLY -1 ? A GLY 33 272 8 Y 1 A SER 0 ? A SER 34 273 9 Y 1 A MET -33 ? A MET 1 274 9 Y 1 A GLY -32 ? A GLY 2 275 9 Y 1 A SER -31 ? A SER 3 276 9 Y 1 A SER -30 ? A SER 4 277 9 Y 1 A HIS -29 ? A HIS 5 278 9 Y 1 A HIS -28 ? A HIS 6 279 9 Y 1 A HIS -27 ? A HIS 7 280 9 Y 1 A HIS -26 ? A HIS 8 281 9 Y 1 A HIS -25 ? A HIS 9 282 9 Y 1 A HIS -24 ? A HIS 10 283 9 Y 1 A SER -23 ? A SER 11 284 9 Y 1 A SER -22 ? A SER 12 285 9 Y 1 A GLY -21 ? A GLY 13 286 9 Y 1 A LEU -20 ? A LEU 14 287 9 Y 1 A VAL -19 ? A VAL 15 288 9 Y 1 A PRO -18 ? A PRO 16 289 9 Y 1 A ARG -17 ? A ARG 17 290 9 Y 1 A GLY -16 ? A GLY 18 291 9 Y 1 A SER -15 ? A SER 19 292 9 Y 1 A HIS -14 ? A HIS 20 293 9 Y 1 A MET -13 ? A MET 21 294 9 Y 1 A ALA -12 ? A ALA 22 295 9 Y 1 A SER -11 ? A SER 23 296 9 Y 1 A MET -10 ? A MET 24 297 9 Y 1 A THR -9 ? A THR 25 298 9 Y 1 A GLY -8 ? A GLY 26 299 9 Y 1 A GLY -7 ? A GLY 27 300 9 Y 1 A GLN -6 ? A GLN 28 301 9 Y 1 A GLN -5 ? A GLN 29 302 9 Y 1 A MET -4 ? A MET 30 303 9 Y 1 A GLY -3 ? A GLY 31 304 9 Y 1 A ARG -2 ? A ARG 32 305 9 Y 1 A GLY -1 ? A GLY 33 306 9 Y 1 A SER 0 ? A SER 34 307 10 Y 1 A MET -33 ? A MET 1 308 10 Y 1 A GLY -32 ? A GLY 2 309 10 Y 1 A SER -31 ? A SER 3 310 10 Y 1 A SER -30 ? A SER 4 311 10 Y 1 A HIS -29 ? A HIS 5 312 10 Y 1 A HIS -28 ? A HIS 6 313 10 Y 1 A HIS -27 ? A HIS 7 314 10 Y 1 A HIS -26 ? A HIS 8 315 10 Y 1 A HIS -25 ? A HIS 9 316 10 Y 1 A HIS -24 ? A HIS 10 317 10 Y 1 A SER -23 ? A SER 11 318 10 Y 1 A SER -22 ? A SER 12 319 10 Y 1 A GLY -21 ? A GLY 13 320 10 Y 1 A LEU -20 ? A LEU 14 321 10 Y 1 A VAL -19 ? A VAL 15 322 10 Y 1 A PRO -18 ? A PRO 16 323 10 Y 1 A ARG -17 ? A ARG 17 324 10 Y 1 A GLY -16 ? A GLY 18 325 10 Y 1 A SER -15 ? A SER 19 326 10 Y 1 A HIS -14 ? A HIS 20 327 10 Y 1 A MET -13 ? A MET 21 328 10 Y 1 A ALA -12 ? A ALA 22 329 10 Y 1 A SER -11 ? A SER 23 330 10 Y 1 A MET -10 ? A MET 24 331 10 Y 1 A THR -9 ? A THR 25 332 10 Y 1 A GLY -8 ? A GLY 26 333 10 Y 1 A GLY -7 ? A GLY 27 334 10 Y 1 A GLN -6 ? A GLN 28 335 10 Y 1 A GLN -5 ? A GLN 29 336 10 Y 1 A MET -4 ? A MET 30 337 10 Y 1 A GLY -3 ? A GLY 31 338 10 Y 1 A ARG -2 ? A ARG 32 339 10 Y 1 A GLY -1 ? A GLY 33 340 10 Y 1 A SER 0 ? A SER 34 341 11 Y 1 A MET -33 ? A MET 1 342 11 Y 1 A GLY -32 ? A GLY 2 343 11 Y 1 A SER -31 ? A SER 3 344 11 Y 1 A SER -30 ? A SER 4 345 11 Y 1 A HIS -29 ? A HIS 5 346 11 Y 1 A HIS -28 ? A HIS 6 347 11 Y 1 A HIS -27 ? A HIS 7 348 11 Y 1 A HIS -26 ? A HIS 8 349 11 Y 1 A HIS -25 ? A HIS 9 350 11 Y 1 A HIS -24 ? A HIS 10 351 11 Y 1 A SER -23 ? A SER 11 352 11 Y 1 A SER -22 ? A SER 12 353 11 Y 1 A GLY -21 ? A GLY 13 354 11 Y 1 A LEU -20 ? A LEU 14 355 11 Y 1 A VAL -19 ? A VAL 15 356 11 Y 1 A PRO -18 ? A PRO 16 357 11 Y 1 A ARG -17 ? A ARG 17 358 11 Y 1 A GLY -16 ? A GLY 18 359 11 Y 1 A SER -15 ? A SER 19 360 11 Y 1 A HIS -14 ? A HIS 20 361 11 Y 1 A MET -13 ? A MET 21 362 11 Y 1 A ALA -12 ? A ALA 22 363 11 Y 1 A SER -11 ? A SER 23 364 11 Y 1 A MET -10 ? A MET 24 365 11 Y 1 A THR -9 ? A THR 25 366 11 Y 1 A GLY -8 ? A GLY 26 367 11 Y 1 A GLY -7 ? A GLY 27 368 11 Y 1 A GLN -6 ? A GLN 28 369 11 Y 1 A GLN -5 ? A GLN 29 370 11 Y 1 A MET -4 ? A MET 30 371 11 Y 1 A GLY -3 ? A GLY 31 372 11 Y 1 A ARG -2 ? A ARG 32 373 11 Y 1 A GLY -1 ? A GLY 33 374 11 Y 1 A SER 0 ? A SER 34 375 12 Y 1 A MET -33 ? A MET 1 376 12 Y 1 A GLY -32 ? A GLY 2 377 12 Y 1 A SER -31 ? A SER 3 378 12 Y 1 A SER -30 ? A SER 4 379 12 Y 1 A HIS -29 ? A HIS 5 380 12 Y 1 A HIS -28 ? A HIS 6 381 12 Y 1 A HIS -27 ? A HIS 7 382 12 Y 1 A HIS -26 ? A HIS 8 383 12 Y 1 A HIS -25 ? A HIS 9 384 12 Y 1 A HIS -24 ? A HIS 10 385 12 Y 1 A SER -23 ? A SER 11 386 12 Y 1 A SER -22 ? A SER 12 387 12 Y 1 A GLY -21 ? A GLY 13 388 12 Y 1 A LEU -20 ? A LEU 14 389 12 Y 1 A VAL -19 ? A VAL 15 390 12 Y 1 A PRO -18 ? A PRO 16 391 12 Y 1 A ARG -17 ? A ARG 17 392 12 Y 1 A GLY -16 ? A GLY 18 393 12 Y 1 A SER -15 ? A SER 19 394 12 Y 1 A HIS -14 ? A HIS 20 395 12 Y 1 A MET -13 ? A MET 21 396 12 Y 1 A ALA -12 ? A ALA 22 397 12 Y 1 A SER -11 ? A SER 23 398 12 Y 1 A MET -10 ? A MET 24 399 12 Y 1 A THR -9 ? A THR 25 400 12 Y 1 A GLY -8 ? A GLY 26 401 12 Y 1 A GLY -7 ? A GLY 27 402 12 Y 1 A GLN -6 ? A GLN 28 403 12 Y 1 A GLN -5 ? A GLN 29 404 12 Y 1 A MET -4 ? A MET 30 405 12 Y 1 A GLY -3 ? A GLY 31 406 12 Y 1 A ARG -2 ? A ARG 32 407 12 Y 1 A GLY -1 ? A GLY 33 408 12 Y 1 A SER 0 ? A SER 34 409 13 Y 1 A MET -33 ? A MET 1 410 13 Y 1 A GLY -32 ? A GLY 2 411 13 Y 1 A SER -31 ? A SER 3 412 13 Y 1 A SER -30 ? A SER 4 413 13 Y 1 A HIS -29 ? A HIS 5 414 13 Y 1 A HIS -28 ? A HIS 6 415 13 Y 1 A HIS -27 ? A HIS 7 416 13 Y 1 A HIS -26 ? A HIS 8 417 13 Y 1 A HIS -25 ? A HIS 9 418 13 Y 1 A HIS -24 ? A HIS 10 419 13 Y 1 A SER -23 ? A SER 11 420 13 Y 1 A SER -22 ? A SER 12 421 13 Y 1 A GLY -21 ? A GLY 13 422 13 Y 1 A LEU -20 ? A LEU 14 423 13 Y 1 A VAL -19 ? A VAL 15 424 13 Y 1 A PRO -18 ? A PRO 16 425 13 Y 1 A ARG -17 ? A ARG 17 426 13 Y 1 A GLY -16 ? A GLY 18 427 13 Y 1 A SER -15 ? A SER 19 428 13 Y 1 A HIS -14 ? A HIS 20 429 13 Y 1 A MET -13 ? A MET 21 430 13 Y 1 A ALA -12 ? A ALA 22 431 13 Y 1 A SER -11 ? A SER 23 432 13 Y 1 A MET -10 ? A MET 24 433 13 Y 1 A THR -9 ? A THR 25 434 13 Y 1 A GLY -8 ? A GLY 26 435 13 Y 1 A GLY -7 ? A GLY 27 436 13 Y 1 A GLN -6 ? A GLN 28 437 13 Y 1 A GLN -5 ? A GLN 29 438 13 Y 1 A MET -4 ? A MET 30 439 13 Y 1 A GLY -3 ? A GLY 31 440 13 Y 1 A ARG -2 ? A ARG 32 441 13 Y 1 A GLY -1 ? A GLY 33 442 13 Y 1 A SER 0 ? A SER 34 443 14 Y 1 A MET -33 ? A MET 1 444 14 Y 1 A GLY -32 ? A GLY 2 445 14 Y 1 A SER -31 ? A SER 3 446 14 Y 1 A SER -30 ? A SER 4 447 14 Y 1 A HIS -29 ? A HIS 5 448 14 Y 1 A HIS -28 ? A HIS 6 449 14 Y 1 A HIS -27 ? A HIS 7 450 14 Y 1 A HIS -26 ? A HIS 8 451 14 Y 1 A HIS -25 ? A HIS 9 452 14 Y 1 A HIS -24 ? A HIS 10 453 14 Y 1 A SER -23 ? A SER 11 454 14 Y 1 A SER -22 ? A SER 12 455 14 Y 1 A GLY -21 ? A GLY 13 456 14 Y 1 A LEU -20 ? A LEU 14 457 14 Y 1 A VAL -19 ? A VAL 15 458 14 Y 1 A PRO -18 ? A PRO 16 459 14 Y 1 A ARG -17 ? A ARG 17 460 14 Y 1 A GLY -16 ? A GLY 18 461 14 Y 1 A SER -15 ? A SER 19 462 14 Y 1 A HIS -14 ? A HIS 20 463 14 Y 1 A MET -13 ? A MET 21 464 14 Y 1 A ALA -12 ? A ALA 22 465 14 Y 1 A SER -11 ? A SER 23 466 14 Y 1 A MET -10 ? A MET 24 467 14 Y 1 A THR -9 ? A THR 25 468 14 Y 1 A GLY -8 ? A GLY 26 469 14 Y 1 A GLY -7 ? A GLY 27 470 14 Y 1 A GLN -6 ? A GLN 28 471 14 Y 1 A GLN -5 ? A GLN 29 472 14 Y 1 A MET -4 ? A MET 30 473 14 Y 1 A GLY -3 ? A GLY 31 474 14 Y 1 A ARG -2 ? A ARG 32 475 14 Y 1 A GLY -1 ? A GLY 33 476 14 Y 1 A SER 0 ? A SER 34 477 15 Y 1 A MET -33 ? A MET 1 478 15 Y 1 A GLY -32 ? A GLY 2 479 15 Y 1 A SER -31 ? A SER 3 480 15 Y 1 A SER -30 ? A SER 4 481 15 Y 1 A HIS -29 ? A HIS 5 482 15 Y 1 A HIS -28 ? A HIS 6 483 15 Y 1 A HIS -27 ? A HIS 7 484 15 Y 1 A HIS -26 ? A HIS 8 485 15 Y 1 A HIS -25 ? A HIS 9 486 15 Y 1 A HIS -24 ? A HIS 10 487 15 Y 1 A SER -23 ? A SER 11 488 15 Y 1 A SER -22 ? A SER 12 489 15 Y 1 A GLY -21 ? A GLY 13 490 15 Y 1 A LEU -20 ? A LEU 14 491 15 Y 1 A VAL -19 ? A VAL 15 492 15 Y 1 A PRO -18 ? A PRO 16 493 15 Y 1 A ARG -17 ? A ARG 17 494 15 Y 1 A GLY -16 ? A GLY 18 495 15 Y 1 A SER -15 ? A SER 19 496 15 Y 1 A HIS -14 ? A HIS 20 497 15 Y 1 A MET -13 ? A MET 21 498 15 Y 1 A ALA -12 ? A ALA 22 499 15 Y 1 A SER -11 ? A SER 23 500 15 Y 1 A MET -10 ? A MET 24 501 15 Y 1 A THR -9 ? A THR 25 502 15 Y 1 A GLY -8 ? A GLY 26 503 15 Y 1 A GLY -7 ? A GLY 27 504 15 Y 1 A GLN -6 ? A GLN 28 505 15 Y 1 A GLN -5 ? A GLN 29 506 15 Y 1 A MET -4 ? A MET 30 507 15 Y 1 A GLY -3 ? A GLY 31 508 15 Y 1 A ARG -2 ? A ARG 32 509 15 Y 1 A GLY -1 ? A GLY 33 510 15 Y 1 A SER 0 ? A SER 34 511 16 Y 1 A MET -33 ? A MET 1 512 16 Y 1 A GLY -32 ? A GLY 2 513 16 Y 1 A SER -31 ? A SER 3 514 16 Y 1 A SER -30 ? A SER 4 515 16 Y 1 A HIS -29 ? A HIS 5 516 16 Y 1 A HIS -28 ? A HIS 6 517 16 Y 1 A HIS -27 ? A HIS 7 518 16 Y 1 A HIS -26 ? A HIS 8 519 16 Y 1 A HIS -25 ? A HIS 9 520 16 Y 1 A HIS -24 ? A HIS 10 521 16 Y 1 A SER -23 ? A SER 11 522 16 Y 1 A SER -22 ? A SER 12 523 16 Y 1 A GLY -21 ? A GLY 13 524 16 Y 1 A LEU -20 ? A LEU 14 525 16 Y 1 A VAL -19 ? A VAL 15 526 16 Y 1 A PRO -18 ? A PRO 16 527 16 Y 1 A ARG -17 ? A ARG 17 528 16 Y 1 A GLY -16 ? A GLY 18 529 16 Y 1 A SER -15 ? A SER 19 530 16 Y 1 A HIS -14 ? A HIS 20 531 16 Y 1 A MET -13 ? A MET 21 532 16 Y 1 A ALA -12 ? A ALA 22 533 16 Y 1 A SER -11 ? A SER 23 534 16 Y 1 A MET -10 ? A MET 24 535 16 Y 1 A THR -9 ? A THR 25 536 16 Y 1 A GLY -8 ? A GLY 26 537 16 Y 1 A GLY -7 ? A GLY 27 538 16 Y 1 A GLN -6 ? A GLN 28 539 16 Y 1 A GLN -5 ? A GLN 29 540 16 Y 1 A MET -4 ? A MET 30 541 16 Y 1 A GLY -3 ? A GLY 31 542 16 Y 1 A ARG -2 ? A ARG 32 543 16 Y 1 A GLY -1 ? A GLY 33 544 16 Y 1 A SER 0 ? A SER 34 545 17 Y 1 A MET -33 ? A MET 1 546 17 Y 1 A GLY -32 ? A GLY 2 547 17 Y 1 A SER -31 ? A SER 3 548 17 Y 1 A SER -30 ? A SER 4 549 17 Y 1 A HIS -29 ? A HIS 5 550 17 Y 1 A HIS -28 ? A HIS 6 551 17 Y 1 A HIS -27 ? A HIS 7 552 17 Y 1 A HIS -26 ? A HIS 8 553 17 Y 1 A HIS -25 ? A HIS 9 554 17 Y 1 A HIS -24 ? A HIS 10 555 17 Y 1 A SER -23 ? A SER 11 556 17 Y 1 A SER -22 ? A SER 12 557 17 Y 1 A GLY -21 ? A GLY 13 558 17 Y 1 A LEU -20 ? A LEU 14 559 17 Y 1 A VAL -19 ? A VAL 15 560 17 Y 1 A PRO -18 ? A PRO 16 561 17 Y 1 A ARG -17 ? A ARG 17 562 17 Y 1 A GLY -16 ? A GLY 18 563 17 Y 1 A SER -15 ? A SER 19 564 17 Y 1 A HIS -14 ? A HIS 20 565 17 Y 1 A MET -13 ? A MET 21 566 17 Y 1 A ALA -12 ? A ALA 22 567 17 Y 1 A SER -11 ? A SER 23 568 17 Y 1 A MET -10 ? A MET 24 569 17 Y 1 A THR -9 ? A THR 25 570 17 Y 1 A GLY -8 ? A GLY 26 571 17 Y 1 A GLY -7 ? A GLY 27 572 17 Y 1 A GLN -6 ? A GLN 28 573 17 Y 1 A GLN -5 ? A GLN 29 574 17 Y 1 A MET -4 ? A MET 30 575 17 Y 1 A GLY -3 ? A GLY 31 576 17 Y 1 A ARG -2 ? A ARG 32 577 17 Y 1 A GLY -1 ? A GLY 33 578 17 Y 1 A SER 0 ? A SER 34 579 18 Y 1 A MET -33 ? A MET 1 580 18 Y 1 A GLY -32 ? A GLY 2 581 18 Y 1 A SER -31 ? A SER 3 582 18 Y 1 A SER -30 ? A SER 4 583 18 Y 1 A HIS -29 ? A HIS 5 584 18 Y 1 A HIS -28 ? A HIS 6 585 18 Y 1 A HIS -27 ? A HIS 7 586 18 Y 1 A HIS -26 ? A HIS 8 587 18 Y 1 A HIS -25 ? A HIS 9 588 18 Y 1 A HIS -24 ? A HIS 10 589 18 Y 1 A SER -23 ? A SER 11 590 18 Y 1 A SER -22 ? A SER 12 591 18 Y 1 A GLY -21 ? A GLY 13 592 18 Y 1 A LEU -20 ? A LEU 14 593 18 Y 1 A VAL -19 ? A VAL 15 594 18 Y 1 A PRO -18 ? A PRO 16 595 18 Y 1 A ARG -17 ? A ARG 17 596 18 Y 1 A GLY -16 ? A GLY 18 597 18 Y 1 A SER -15 ? A SER 19 598 18 Y 1 A HIS -14 ? A HIS 20 599 18 Y 1 A MET -13 ? A MET 21 600 18 Y 1 A ALA -12 ? A ALA 22 601 18 Y 1 A SER -11 ? A SER 23 602 18 Y 1 A MET -10 ? A MET 24 603 18 Y 1 A THR -9 ? A THR 25 604 18 Y 1 A GLY -8 ? A GLY 26 605 18 Y 1 A GLY -7 ? A GLY 27 606 18 Y 1 A GLN -6 ? A GLN 28 607 18 Y 1 A GLN -5 ? A GLN 29 608 18 Y 1 A MET -4 ? A MET 30 609 18 Y 1 A GLY -3 ? A GLY 31 610 18 Y 1 A ARG -2 ? A ARG 32 611 18 Y 1 A GLY -1 ? A GLY 33 612 18 Y 1 A SER 0 ? A SER 34 613 19 Y 1 A MET -33 ? A MET 1 614 19 Y 1 A GLY -32 ? A GLY 2 615 19 Y 1 A SER -31 ? A SER 3 616 19 Y 1 A SER -30 ? A SER 4 617 19 Y 1 A HIS -29 ? A HIS 5 618 19 Y 1 A HIS -28 ? A HIS 6 619 19 Y 1 A HIS -27 ? A HIS 7 620 19 Y 1 A HIS -26 ? A HIS 8 621 19 Y 1 A HIS -25 ? A HIS 9 622 19 Y 1 A HIS -24 ? A HIS 10 623 19 Y 1 A SER -23 ? A SER 11 624 19 Y 1 A SER -22 ? A SER 12 625 19 Y 1 A GLY -21 ? A GLY 13 626 19 Y 1 A LEU -20 ? A LEU 14 627 19 Y 1 A VAL -19 ? A VAL 15 628 19 Y 1 A PRO -18 ? A PRO 16 629 19 Y 1 A ARG -17 ? A ARG 17 630 19 Y 1 A GLY -16 ? A GLY 18 631 19 Y 1 A SER -15 ? A SER 19 632 19 Y 1 A HIS -14 ? A HIS 20 633 19 Y 1 A MET -13 ? A MET 21 634 19 Y 1 A ALA -12 ? A ALA 22 635 19 Y 1 A SER -11 ? A SER 23 636 19 Y 1 A MET -10 ? A MET 24 637 19 Y 1 A THR -9 ? A THR 25 638 19 Y 1 A GLY -8 ? A GLY 26 639 19 Y 1 A GLY -7 ? A GLY 27 640 19 Y 1 A GLN -6 ? A GLN 28 641 19 Y 1 A GLN -5 ? A GLN 29 642 19 Y 1 A MET -4 ? A MET 30 643 19 Y 1 A GLY -3 ? A GLY 31 644 19 Y 1 A ARG -2 ? A ARG 32 645 19 Y 1 A GLY -1 ? A GLY 33 646 19 Y 1 A SER 0 ? A SER 34 647 20 Y 1 A MET -33 ? A MET 1 648 20 Y 1 A GLY -32 ? A GLY 2 649 20 Y 1 A SER -31 ? A SER 3 650 20 Y 1 A SER -30 ? A SER 4 651 20 Y 1 A HIS -29 ? A HIS 5 652 20 Y 1 A HIS -28 ? A HIS 6 653 20 Y 1 A HIS -27 ? A HIS 7 654 20 Y 1 A HIS -26 ? A HIS 8 655 20 Y 1 A HIS -25 ? A HIS 9 656 20 Y 1 A HIS -24 ? A HIS 10 657 20 Y 1 A SER -23 ? A SER 11 658 20 Y 1 A SER -22 ? A SER 12 659 20 Y 1 A GLY -21 ? A GLY 13 660 20 Y 1 A LEU -20 ? A LEU 14 661 20 Y 1 A VAL -19 ? A VAL 15 662 20 Y 1 A PRO -18 ? A PRO 16 663 20 Y 1 A ARG -17 ? A ARG 17 664 20 Y 1 A GLY -16 ? A GLY 18 665 20 Y 1 A SER -15 ? A SER 19 666 20 Y 1 A HIS -14 ? A HIS 20 667 20 Y 1 A MET -13 ? A MET 21 668 20 Y 1 A ALA -12 ? A ALA 22 669 20 Y 1 A SER -11 ? A SER 23 670 20 Y 1 A MET -10 ? A MET 24 671 20 Y 1 A THR -9 ? A THR 25 672 20 Y 1 A GLY -8 ? A GLY 26 673 20 Y 1 A GLY -7 ? A GLY 27 674 20 Y 1 A GLN -6 ? A GLN 28 675 20 Y 1 A GLN -5 ? A GLN 29 676 20 Y 1 A MET -4 ? A MET 30 677 20 Y 1 A GLY -3 ? A GLY 31 678 20 Y 1 A ARG -2 ? A ARG 32 679 20 Y 1 A GLY -1 ? A GLY 33 680 20 Y 1 A SER 0 ? A SER 34 # _ndb_struct_conf_na.entry_id 2KFY _ndb_struct_conf_na.feature 'double helix' # _ndb_struct_na_base_pair.model_number 1 _ndb_struct_na_base_pair.i_label_asym_id B _ndb_struct_na_base_pair.i_label_comp_id G _ndb_struct_na_base_pair.i_label_seq_id 2 _ndb_struct_na_base_pair.i_symmetry 1_555 _ndb_struct_na_base_pair.j_label_asym_id B _ndb_struct_na_base_pair.j_label_comp_id G _ndb_struct_na_base_pair.j_label_seq_id 4 _ndb_struct_na_base_pair.j_symmetry 1_555 _ndb_struct_na_base_pair.shear -5.536 _ndb_struct_na_base_pair.stretch 1.279 _ndb_struct_na_base_pair.stagger -1.391 _ndb_struct_na_base_pair.buckle -44.523 _ndb_struct_na_base_pair.propeller -11.806 _ndb_struct_na_base_pair.opening -72.416 _ndb_struct_na_base_pair.pair_number 1 _ndb_struct_na_base_pair.pair_name B_G2:G4_B _ndb_struct_na_base_pair.i_auth_asym_id B _ndb_struct_na_base_pair.i_auth_seq_id 2 _ndb_struct_na_base_pair.i_PDB_ins_code ? _ndb_struct_na_base_pair.j_auth_asym_id B _ndb_struct_na_base_pair.j_auth_seq_id 4 _ndb_struct_na_base_pair.j_PDB_ins_code ? _ndb_struct_na_base_pair.hbond_type_28 ? _ndb_struct_na_base_pair.hbond_type_12 5 #