data_2KHR # _entry.id 2KHR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KHR pdb_00002khr 10.2210/pdb2khr/pdb RCSB RCSB101136 ? ? WWPDB D_1000101136 ? ? BMRB 16253 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 16253 . unspecified TargetDB MytuD.1649.a . unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KHR _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-04-10 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Buchko, G.W.' 1 'Kim, C.Y.' 2 'Terwilliger, T.C.' 3 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 4 # _citation.id primary _citation.title 'Solution structure of Rv2377c-founding member of the MbtH-like protein family.' _citation.journal_abbrev 'Tuberculosis (Edinb)' _citation.journal_volume 90 _citation.page_first 245 _citation.page_last 251 _citation.year 2010 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1472-9792 _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20434955 _citation.pdbx_database_id_DOI 10.1016/j.tube.2010.04.002 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Buchko, G.W.' 1 ? primary 'Kim, C.Y.' 2 ? primary 'Terwilliger, T.C.' 3 ? primary 'Myler, P.J.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein mbtH' _entity.formula_weight 8372.165 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSHMSTNPFDDDNGAFFVLVNDEDQHSLWPVFADIPAGWRVVHGEASRAACLDYVEKNWTDLRPKSLRDAMVED _entity_poly.pdbx_seq_one_letter_code_can GSHMSTNPFDDDNGAFFVLVNDEDQHSLWPVFADIPAGWRVVHGEASRAACLDYVEKNWTDLRPKSLRDAMVED _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier MytuD.1649.a # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 SER n 1 6 THR n 1 7 ASN n 1 8 PRO n 1 9 PHE n 1 10 ASP n 1 11 ASP n 1 12 ASP n 1 13 ASN n 1 14 GLY n 1 15 ALA n 1 16 PHE n 1 17 PHE n 1 18 VAL n 1 19 LEU n 1 20 VAL n 1 21 ASN n 1 22 ASP n 1 23 GLU n 1 24 ASP n 1 25 GLN n 1 26 HIS n 1 27 SER n 1 28 LEU n 1 29 TRP n 1 30 PRO n 1 31 VAL n 1 32 PHE n 1 33 ALA n 1 34 ASP n 1 35 ILE n 1 36 PRO n 1 37 ALA n 1 38 GLY n 1 39 TRP n 1 40 ARG n 1 41 VAL n 1 42 VAL n 1 43 HIS n 1 44 GLY n 1 45 GLU n 1 46 ALA n 1 47 SER n 1 48 ARG n 1 49 ALA n 1 50 ALA n 1 51 CYS n 1 52 LEU n 1 53 ASP n 1 54 TYR n 1 55 VAL n 1 56 GLU n 1 57 LYS n 1 58 ASN n 1 59 TRP n 1 60 THR n 1 61 ASP n 1 62 LEU n 1 63 ARG n 1 64 PRO n 1 65 LYS n 1 66 SER n 1 67 LEU n 1 68 ARG n 1 69 ASP n 1 70 ALA n 1 71 MET n 1 72 VAL n 1 73 GLU n 1 74 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'mbtH, MT2445.1, MTCY27.03, Rv2377c' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21PRO _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'modifed pET28b' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MBTH_MYCTU _struct_ref.pdbx_db_accession O05821 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MSTNPFDDDNGAFFVLVNDEDQHSLWPVFADIPAGWRVVHGEASRAACLDYVEKNWTDLRPKSLRDAMVED _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KHR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 74 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O05821 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 71 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 74 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KHR GLY A 1 ? UNP O05821 ? ? 'expression tag' 1 1 1 2KHR SER A 2 ? UNP O05821 ? ? 'expression tag' 2 2 1 2KHR HIS A 3 ? UNP O05821 ? ? 'expression tag' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-15N NOESY' 1 3 1 '3D 1H-13C NOESY' 1 4 1 '3D 1H-15N TOCSY' 1 5 1 '3D HNCACB' 1 6 1 '3D HNCO' 1 7 1 '3D HN(COCA)CB' 1 8 1 '3D C(CO)NH' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '2D 1H-13C HSQC' 1 11 1 '3D H(CCO)NH' 1 12 2 'deuterium X-change' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.32 _pdbx_nmr_exptl_sample_conditions.pH 7.1 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '2 mM [U-98% 13C; U-98% 15N] Rv2377c, 300 mM sodium chloride, 20 mM TRIS, 1 mM DTT, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '2 mM [U-98% 13C; U-98% 15N] Rv2377c, 300 mM sodium chloride, 20 mM TRIS, 1 mM DTT, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 750 Varian INOVA 1 'Varian INOVA' 900 Varian INOVA 2 'Varian INOVA' 600 Varian INOVA 3 'Varian INOVA' 500 Varian UNITYPLUS 4 'Varian UnityPlus' # _pdbx_nmr_refine.entry_id 2KHR _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;STRUCTURE DETERMINATION WAS PERFORMED ITERATIVELY USING CYANA (AUTOMATED NOESYASSIGNMENTS). A TOTAL OF 20 STRUCTURES OUT OF 100 WITH LOWEST TARGET FUNCTION FROM THE FINAL CYANA CALCULATION WERE TAKEN AND REFINED BY RESTRAINED MOLECULAR DYNAMICS/ENERGY REMARK IN EXPLICIT WATER (CNS) AFTER ADDING 10% TO THE UPPER BOUNDARY LIMIT. THE FINAL SET OF STRUCTURES CONTAINED NO DIHEDRAL VIOLATIONS GREATER THAN 2 DEGREE OR DISTANCE VIOLATIONS TOTAL THAT WERE GREATER THAN 0.05 ANGSTROM. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KHR _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.05 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.05 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KHR _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 2 'Accelrys Software Inc.' processing Felix 2007 3 Goddard 'chemical shift assignment' Sparky 3.115 4 Goddard 'peak picking' Sparky 3.115 5 'Bhattacharya and Montelione' 'data analysis' PSVS ? 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KHR _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KHR _struct.title 'Solution structure of Rv2377c, a MbtH-like protein from Mycobacterium tuberculosis' _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KHR _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' _struct_keywords.text ;siderophores, mycobactin, MtbH-like, 2-hydroxyphenyloxazoline, tuberculosis, BIOSYNTHETIC PROTEIN, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 47 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 61 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 47 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 61 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 27 ? PRO A 30 ? SER A 27 PRO A 30 A 2 PHE A 16 ? ASN A 21 ? PHE A 16 ASN A 21 A 3 TRP A 39 ? HIS A 43 ? TRP A 39 HIS A 43 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TRP A 29 ? O TRP A 29 N PHE A 17 ? N PHE A 17 A 2 3 N VAL A 18 ? N VAL A 18 O HIS A 43 ? O HIS A 43 # _atom_sites.entry_id 2KHR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ASP 74 74 74 ASP ASP A . n # _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center SSGCID _pdbx_SG_project.project_name ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-05-05 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Rv2377c-1 2 ? mM '[U-98% 13C; U-98% 15N]' 1 'sodium chloride-2' 300 ? mM ? 1 TRIS-3 20 ? mM ? 1 DTT-4 1 ? mM ? 1 Rv2377c-5 2 ? mM '[U-98% 13C; U-98% 15N]' 2 'sodium chloride-6' 300 ? mM ? 2 TRIS-7 20 ? mM ? 2 DTT-8 1 ? mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KHR _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 602 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 142 _pdbx_nmr_constraints.NOE_long_range_total_count 187 _pdbx_nmr_constraints.NOE_medium_range_total_count 77 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 196 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 HE1 A HIS 43 ? ? HB1 A ALA 46 ? ? 1.24 2 5 HB2 A ASN 21 ? ? HB3 A ASP 24 ? ? 1.22 3 6 OD2 A ASP 53 ? ? HZ2 A LYS 57 ? ? 1.58 4 7 HE1 A PHE 17 ? ? HG3 A GLU 45 ? ? 1.29 5 7 HE1 A HIS 43 ? ? HB3 A ALA 46 ? ? 1.33 6 15 HE1 A PHE 17 ? ? HG3 A GLU 45 ? ? 1.31 7 16 OE1 A GLU 56 ? ? HZ3 A LYS 65 ? ? 1.59 8 17 OD2 A ASP 53 ? ? HZ2 A LYS 57 ? ? 1.59 9 18 HD22 A ASN 7 ? ? HB2 A ASP 10 ? ? 1.29 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 4 ? ? -59.99 106.98 2 1 ASN A 13 ? ? -100.19 -66.39 3 1 PHE A 32 ? ? -161.53 -33.09 4 1 PRO A 36 ? ? -78.75 -106.21 5 1 SER A 47 ? ? -30.89 128.31 6 1 SER A 66 ? ? 65.18 100.66 7 1 ASP A 69 ? ? 61.10 72.17 8 2 PHE A 32 ? ? -159.17 -36.48 9 2 PRO A 36 ? ? -69.44 -155.93 10 2 TRP A 59 ? ? 53.09 89.82 11 2 ASP A 61 ? ? -97.89 -157.21 12 2 LEU A 67 ? ? -122.26 -65.30 13 3 PRO A 36 ? ? -72.43 -152.04 14 3 ARG A 68 ? ? -132.76 -40.03 15 4 PHE A 9 ? ? -97.47 -159.42 16 4 PRO A 36 ? ? -85.04 -107.96 17 4 SER A 47 ? ? -31.36 127.80 18 4 LYS A 65 ? ? -65.06 97.78 19 4 MET A 71 ? ? 54.06 79.63 20 4 GLU A 73 ? ? 70.17 84.18 21 5 MET A 4 ? ? 61.29 77.55 22 5 VAL A 31 ? ? -69.79 2.50 23 5 PRO A 36 ? ? -72.90 -157.15 24 5 GLU A 45 ? ? -69.08 98.40 25 5 SER A 47 ? ? -35.71 128.27 26 6 ASP A 11 ? ? -112.33 -161.28 27 6 PRO A 36 ? ? -77.99 -101.50 28 7 ASN A 13 ? ? -157.36 -157.67 29 7 PRO A 36 ? ? -75.49 -153.25 30 7 SER A 47 ? ? -31.41 128.19 31 7 TRP A 59 ? ? 62.98 83.78 32 7 ARG A 63 ? ? 58.59 85.26 33 7 LYS A 65 ? ? -161.35 95.75 34 7 SER A 66 ? ? -63.06 95.37 35 7 LEU A 67 ? ? -173.35 -30.62 36 8 PRO A 8 ? ? -79.78 23.44 37 8 ASN A 13 ? ? -160.04 101.64 38 8 PRO A 36 ? ? -72.47 -154.72 39 8 THR A 60 ? ? 64.27 80.23 40 9 ASP A 24 ? ? -129.37 -166.48 41 9 GLN A 25 ? ? -125.46 -53.47 42 9 PRO A 36 ? ? -68.78 -163.38 43 9 SER A 47 ? ? -39.29 128.40 44 9 LEU A 62 ? ? -92.65 34.81 45 9 PRO A 64 ? ? -33.58 114.18 46 10 ASP A 10 ? ? 73.53 -52.74 47 10 GLN A 25 ? ? -129.39 -52.79 48 10 PRO A 36 ? ? -68.96 -98.60 49 10 LEU A 62 ? ? 69.42 90.18 50 10 LYS A 65 ? ? -56.09 106.52 51 10 VAL A 72 ? ? -90.84 -61.61 52 11 PRO A 8 ? ? -74.95 31.76 53 11 SER A 47 ? ? -33.82 128.20 54 11 TRP A 59 ? ? 59.58 79.14 55 12 PHE A 9 ? ? 55.28 80.66 56 12 PRO A 36 ? ? -65.91 -164.50 57 12 LYS A 65 ? ? -66.44 91.38 58 12 ASP A 69 ? ? 64.49 109.88 59 13 PRO A 36 ? ? -84.47 -153.30 60 13 SER A 47 ? ? -39.48 128.52 61 13 TRP A 59 ? ? 69.33 -66.29 62 13 THR A 60 ? ? -134.52 -54.03 63 13 LEU A 62 ? ? -157.12 1.58 64 13 ARG A 63 ? ? -177.60 136.51 65 13 SER A 66 ? ? -172.96 -175.65 66 13 ASP A 69 ? ? 65.44 99.32 67 13 GLU A 73 ? ? -160.01 113.29 68 14 PRO A 8 ? ? -74.50 39.79 69 14 PHE A 9 ? ? -123.52 -94.16 70 14 PRO A 36 ? ? -68.19 -99.00 71 14 PRO A 64 ? ? -68.16 85.52 72 14 MET A 71 ? ? -104.84 65.13 73 15 HIS A 3 ? ? -152.44 49.79 74 15 PRO A 8 ? ? -79.22 30.38 75 15 ASP A 11 ? ? -134.17 -39.28 76 15 PRO A 36 ? ? -86.33 -104.34 77 15 ASP A 61 ? ? -67.06 96.64 78 16 ASN A 21 ? ? -116.17 -169.56 79 16 VAL A 31 ? ? -76.34 -169.72 80 16 PHE A 32 ? ? 74.11 -49.32 81 16 PRO A 36 ? ? -62.18 -159.97 82 16 SER A 66 ? ? -165.24 101.33 83 17 PRO A 36 ? ? -74.51 -149.00 84 17 HIS A 43 ? ? -170.96 139.90 85 17 SER A 47 ? ? -37.23 127.82 86 17 ALA A 70 ? ? -161.22 4.86 87 17 VAL A 72 ? ? -167.62 109.14 88 17 GLU A 73 ? ? 67.27 85.37 89 18 SER A 2 ? ? 72.81 -25.75 90 18 PHE A 9 ? ? -92.65 -63.55 91 18 ASN A 21 ? ? -120.33 -168.91 92 18 PRO A 36 ? ? -70.18 -151.27 93 18 SER A 47 ? ? -37.88 128.21 94 18 TRP A 59 ? ? -112.39 -70.83 95 18 ARG A 63 ? ? -165.94 91.41 96 19 SER A 5 ? ? -68.40 96.84 97 19 ASP A 11 ? ? -64.04 91.70 98 19 PRO A 36 ? ? -69.40 -163.17 99 19 TRP A 59 ? ? 73.47 -47.92 100 19 LEU A 67 ? ? -137.09 -57.90 101 19 ARG A 68 ? ? -159.17 86.96 102 20 PRO A 36 ? ? -83.65 -105.47 103 20 SER A 47 ? ? -31.48 127.75 104 20 LEU A 62 ? ? -88.03 -72.21 #