data_2KHT # _entry.id 2KHT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.323 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2KHT RCSB RCSB101138 WWPDB D_1000101138 BMRB 16254 # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 16254 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KHT _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-04-11 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, Y.' 1 'Li, S.' 2 'Doherty, T.F.' 3 'Lubkowski, J.' 4 'Lu, W.' 5 'Li, J.' 6 'Barinka, C.' 7 'Hong, M.' 8 # _citation.id primary _citation.title 'Resonance assignment and three-dimensional structure determination of a human alpha-defensin, HNP-1, by solid-state NMR.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 397 _citation.page_first 408 _citation.page_last 422 _citation.year 2010 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20097206 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2010.01.030 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, Y.' 1 ? primary 'Doherty, T.' 2 ? primary 'Li, J.' 3 ? primary 'Lu, W.' 4 ? primary 'Barinka, C.' 5 ? primary 'Lubkowski, J.' 6 ? primary 'Hong, M.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Neutrophil defensin 1' _entity.formula_weight 3452.111 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Residues 65-94' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HNP-1, HP-1, HP1, Defensin, alpha 1, HP 1-56, Neutrophil defensin 2, HNP-2, HP-2, HP2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ACYCRIPACIAGERRYGTCIYQGRLWAFCC _entity_poly.pdbx_seq_one_letter_code_can ACYCRIPACIAGERRYGTCIYQGRLWAFCC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 CYS n 1 3 TYR n 1 4 CYS n 1 5 ARG n 1 6 ILE n 1 7 PRO n 1 8 ALA n 1 9 CYS n 1 10 ILE n 1 11 ALA n 1 12 GLY n 1 13 GLU n 1 14 ARG n 1 15 ARG n 1 16 TYR n 1 17 GLY n 1 18 THR n 1 19 CYS n 1 20 ILE n 1 21 TYR n 1 22 GLN n 1 23 GLY n 1 24 ARG n 1 25 LEU n 1 26 TRP n 1 27 ALA n 1 28 PHE n 1 29 CYS n 1 30 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DEF1, DEFA1, DEFA2, MRS' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-2T _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DEF1_HUMAN _struct_ref.pdbx_db_accession P59665 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ACYCRIPACIAGERRYGTCIYQGRLWAFCC _struct_ref.pdbx_align_begin 65 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KHT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6EZF6 _struct_ref_seq.db_align_beg 65 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 94 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 30 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 13C-13C DARR 40 ms, 100 ms & 200 ms' 1 2 1 '2D 15N-15N PDSD 3 s' 2 3 1 '2D CM5RR 0.8 ms & 1.5 ms' 2 4 1 '2D CHHC 200 us & 300 us' 1 5 1 '3D 15N-13C-13C NCACX' 1 6 1 '3D 15N-13C-13C NCOCX' 2 7 1 '2D 15N-13C NCX' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 ? 6.5 1 atm 268 K 2 ? 6.5 1 atm 253 K # _pdbx_nmr_sample_details.contents 'Polycrystalline sample grown from 60% w/v PEG400, 30 mM Cacodylate, 60 mM Lithium Sulfate' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system ? # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 900 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KHT _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 12.41 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KHT _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.53 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 22.622 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 2.68 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method TALOS # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KHT _pdbx_nmr_representative.selection_criteria 'minimized average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 2.21 1 Goddard 'chemical shift assignment' Sparky 3.113 2 'Bruker Biospin' processing TopSpin 1.3 3 'Pettersen, E.F., Goddard, T.D., Huang, C.C., Couch, G.S., Greenblatt, D.M., Meng, E.C., and Ferrin, T.E' refinement UCSF-Chimera 1.3 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'HNP-1 structure determination through 2D & 3D CC and NC correlation experiments by solid state NMR.' _exptl.entry_id 2KHT _exptl.method 'SOLID-STATE NMR' _exptl.method_details ? # _struct.entry_id 2KHT _struct.title 'NMR Structure of human alpha defensin HNP-1' _struct.pdbx_descriptor 'Defensin, alpha 1' _struct.pdbx_model_details 'minimized average, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KHT _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' _struct_keywords.text ;microcrystalline protein, human alpha defensin, Defensin, Secreted, Antibiotic, Antiviral defense, Fungicide, Phosphoprotein, ANTIMICROBIAL PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _atom_sites.entry_id 2KHT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 CYS 30 30 30 CYS CYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-02-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2014-02-05 4 'Structure model' 1 3 2020-02-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Experimental preparation' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.58 _pdbx_nmr_ensemble_rms.distance_rms_dev_error ? _pdbx_nmr_ensemble_rms.entry_id 2KHT _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KHT _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total ? _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 28 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 28 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 O A ALA 8 ? ? H A ILE 10 ? ? 1.60 2 7 H A ARG 5 ? ? O A LEU 25 ? ? 1.59 3 9 O A ILE 6 ? ? H A ALA 8 ? ? 1.45 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 7 ? ? -46.04 72.65 2 1 CYS A 9 ? ? -58.63 69.81 3 1 ALA A 11 ? ? -54.01 -164.90 4 2 PRO A 7 ? ? -47.19 85.27 5 2 CYS A 9 ? ? -56.66 68.95 6 2 TYR A 16 ? ? -146.65 -95.33 7 2 GLN A 22 ? ? 50.17 15.61 8 3 PRO A 7 ? ? -47.86 76.27 9 3 ALA A 8 ? ? -175.02 110.36 10 3 TYR A 16 ? ? -148.55 -103.29 11 3 GLN A 22 ? ? 52.32 13.74 12 4 PRO A 7 ? ? -61.82 24.66 13 4 CYS A 9 ? ? -62.85 99.29 14 4 TYR A 16 ? ? -148.63 -99.15 15 4 GLN A 22 ? ? 51.87 12.39 16 5 PRO A 7 ? ? -47.40 90.79 17 5 CYS A 9 ? ? -57.52 76.76 18 6 PRO A 7 ? ? -48.90 -6.18 19 6 CYS A 9 ? ? 155.25 5.19 20 6 TYR A 16 ? ? -102.08 -101.70 21 6 GLN A 22 ? ? 49.10 21.42 22 7 PRO A 7 ? ? -46.93 95.39 23 7 CYS A 9 ? ? -54.37 75.97 24 7 TYR A 16 ? ? -108.10 -65.15 25 7 GLN A 22 ? ? 55.69 12.54 26 8 PRO A 7 ? ? -46.20 75.31 27 8 ALA A 8 ? ? -174.91 109.16 28 8 TYR A 16 ? ? -147.22 -72.48 29 8 GLN A 22 ? ? 56.58 12.29 30 9 PRO A 7 ? ? -50.86 54.88 31 9 ALA A 8 ? ? -175.14 101.82 32 9 CYS A 9 ? ? 151.36 -8.24 33 9 TYR A 16 ? ? -147.41 -91.16 34 9 GLN A 22 ? ? 59.76 12.18 35 10 PRO A 7 ? ? -47.79 87.05 36 10 ALA A 8 ? ? -167.76 -160.90 37 10 CYS A 9 ? ? -54.63 70.46 38 10 TYR A 16 ? ? -147.19 -106.87 39 10 GLN A 22 ? ? 52.33 12.75 #