data_2KI2 # _entry.id 2KI2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KI2 pdb_00002ki2 10.2210/pdb2ki2/pdb RCSB RCSB101147 ? ? WWPDB D_1000101147 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-10-20 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_spectrometer 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KI2 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2009-04-20 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ma, C.' 1 'Lee, J.' 2 'Kim, J.' 3 'Park, S.' 4 'Kwon, A.' 5 'Lee, B.' 6 # _citation.id primary _citation.title 'NMR solution structure of HP0827 (O25501_HELPY) from Helicobacter pylori: model of the possible RNA-binding site' _citation.journal_abbrev J.Biochem. _citation.journal_volume 146 _citation.page_first 667 _citation.page_last 674 _citation.year 2009 _citation.journal_id_ASTM ? _citation.country JP _citation.journal_id_ISSN 0021-924X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19605462 _citation.pdbx_database_id_DOI 10.1093/jb/mvp105 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jang, S.B.' 1 ? primary 'Ma, C.' 2 ? primary 'Lee, J.Y.' 3 ? primary 'Kim, J.H.' 4 ? primary 'Park, S.J.' 5 ? primary 'Kwon, A.R.' 6 ? primary 'Lee, B.J.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ss-DNA binding protein 12RNP2' _entity.formula_weight 10469.880 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRNIYVGNLVYSATSEQVKELFSQFGKVFNVKLIYDRETKKPKGFGFVEMQEESVSEAIAKLDNTDFMGRTIRVTEANPK KSLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MRNIYVGNLVYSATSEQVKELFSQFGKVFNVKLIYDRETKKPKGFGFVEMQEESVSEAIAKLDNTDFMGRTIRVTEANPK KSLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 ASN n 1 4 ILE n 1 5 TYR n 1 6 VAL n 1 7 GLY n 1 8 ASN n 1 9 LEU n 1 10 VAL n 1 11 TYR n 1 12 SER n 1 13 ALA n 1 14 THR n 1 15 SER n 1 16 GLU n 1 17 GLN n 1 18 VAL n 1 19 LYS n 1 20 GLU n 1 21 LEU n 1 22 PHE n 1 23 SER n 1 24 GLN n 1 25 PHE n 1 26 GLY n 1 27 LYS n 1 28 VAL n 1 29 PHE n 1 30 ASN n 1 31 VAL n 1 32 LYS n 1 33 LEU n 1 34 ILE n 1 35 TYR n 1 36 ASP n 1 37 ARG n 1 38 GLU n 1 39 THR n 1 40 LYS n 1 41 LYS n 1 42 PRO n 1 43 LYS n 1 44 GLY n 1 45 PHE n 1 46 GLY n 1 47 PHE n 1 48 VAL n 1 49 GLU n 1 50 MET n 1 51 GLN n 1 52 GLU n 1 53 GLU n 1 54 SER n 1 55 VAL n 1 56 SER n 1 57 GLU n 1 58 ALA n 1 59 ILE n 1 60 ALA n 1 61 LYS n 1 62 LEU n 1 63 ASP n 1 64 ASN n 1 65 THR n 1 66 ASP n 1 67 PHE n 1 68 MET n 1 69 GLY n 1 70 ARG n 1 71 THR n 1 72 ILE n 1 73 ARG n 1 74 VAL n 1 75 THR n 1 76 GLU n 1 77 ALA n 1 78 ASN n 1 79 PRO n 1 80 LYS n 1 81 LYS n 1 82 SER n 1 83 LEU n 1 84 GLU n 1 85 HIS n 1 86 HIS n 1 87 HIS n 1 88 HIS n 1 89 HIS n 1 90 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Campylobacter pylori' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene HP_0827 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Helicobacter pylori' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 210 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-21a(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ASN 78 78 ? ? ? A . n A 1 79 PRO 79 79 ? ? ? A . n A 1 80 LYS 80 80 ? ? ? A . n A 1 81 LYS 81 81 ? ? ? A . n A 1 82 SER 82 82 ? ? ? A . n A 1 83 LEU 83 83 ? ? ? A . n A 1 84 GLU 84 84 ? ? ? A . n A 1 85 HIS 85 85 ? ? ? A . n A 1 86 HIS 86 86 ? ? ? A . n A 1 87 HIS 87 87 ? ? ? A . n A 1 88 HIS 88 88 ? ? ? A . n A 1 89 HIS 89 89 ? ? ? A . n A 1 90 HIS 90 90 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KI2 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KI2 _struct.title 'Solution Structure of ss-DNA Binding Protein 12RNP2 Precursor, HP0827(O25501_HELPY) form Helicobacter pylori' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KI2 _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN/ss-DNA BINDING PROTEIN' _struct_keywords.text 'HP0827, Helicobacter Pylori, RRM, RNP1, RNP2, ss-DNA binding proteins, RNA BINDING PROTEIN-ss-DNA BINDING PROTEIN COMPLEX' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O25501_HELPY _struct_ref.pdbx_db_accession O25501 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRNIYVGNLVYSATSEQVKELFSQFGKVFNVKLIYDRETKKPKGFGFVEMQEESVSEAIAKLDNTDFMGRTIRVTEANPK KS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KI2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O25501 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 82 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 82 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KI2 LEU A 83 ? UNP O25501 ? ? 'expression tag' 83 1 1 2KI2 GLU A 84 ? UNP O25501 ? ? 'expression tag' 84 2 1 2KI2 HIS A 85 ? UNP O25501 ? ? 'expression tag' 85 3 1 2KI2 HIS A 86 ? UNP O25501 ? ? 'expression tag' 86 4 1 2KI2 HIS A 87 ? UNP O25501 ? ? 'expression tag' 87 5 1 2KI2 HIS A 88 ? UNP O25501 ? ? 'expression tag' 88 6 1 2KI2 HIS A 89 ? UNP O25501 ? ? 'expression tag' 89 7 1 2KI2 HIS A 90 ? UNP O25501 ? ? 'expression tag' 90 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 14 ? LYS A 19 ? THR A 14 LYS A 19 1 ? 6 HELX_P HELX_P2 2 LEU A 21 ? GLY A 26 ? LEU A 21 GLY A 26 1 ? 6 HELX_P HELX_P3 3 GLU A 53 ? LYS A 61 ? GLU A 53 LYS A 61 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 30 ? LEU A 33 ? ASN A 30 LEU A 33 A 2 GLY A 44 ? MET A 50 ? GLY A 44 MET A 50 A 3 ARG A 2 ? LEU A 9 ? ARG A 2 LEU A 9 A 4 VAL A 74 ? GLU A 76 ? VAL A 74 GLU A 76 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASN A 30 ? N ASN A 30 O GLU A 49 ? O GLU A 49 A 2 3 O GLY A 46 ? O GLY A 46 N VAL A 6 ? N VAL A 6 A 3 4 N TYR A 5 ? N TYR A 5 O THR A 75 ? O THR A 75 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 13 ? ? -77.38 -76.38 2 1 THR A 14 ? ? -163.49 -23.04 3 1 GLU A 38 ? ? -165.34 -43.07 4 1 LYS A 43 ? ? -170.20 109.19 5 1 GLN A 51 ? ? -60.00 179.75 6 1 GLU A 52 ? ? -96.20 35.52 7 1 LEU A 62 ? ? -90.04 -75.11 8 1 ASN A 64 ? ? 179.96 -67.67 9 1 THR A 71 ? ? -137.94 -65.21 10 1 ILE A 72 ? ? 59.74 159.38 11 2 ALA A 13 ? ? -58.46 -70.85 12 2 THR A 14 ? ? 175.23 -28.44 13 2 GLU A 38 ? ? -157.02 -54.08 14 2 LEU A 62 ? ? -85.40 -75.15 15 2 ASN A 64 ? ? 178.78 -61.12 16 2 MET A 68 ? ? -96.83 32.27 17 2 THR A 71 ? ? -137.92 -61.55 18 2 ILE A 72 ? ? 59.94 162.57 19 3 VAL A 10 ? ? -167.97 -167.71 20 3 SER A 12 ? ? -152.44 53.26 21 3 THR A 14 ? ? 177.07 -33.63 22 3 LYS A 32 ? ? -175.21 131.92 23 3 ARG A 37 ? ? -94.71 46.52 24 3 GLU A 38 ? ? -176.52 -40.40 25 3 LYS A 43 ? ? -60.63 -70.11 26 3 LEU A 62 ? ? -89.99 -75.18 27 3 ASN A 64 ? ? -176.98 -43.89 28 3 PHE A 67 ? ? -118.69 -168.95 29 3 MET A 68 ? ? -91.38 52.25 30 3 THR A 71 ? ? -140.31 -59.20 31 3 ILE A 72 ? ? 59.38 161.36 32 4 SER A 12 ? ? -142.61 54.97 33 4 THR A 14 ? ? -179.80 -36.03 34 4 TYR A 35 ? ? 49.69 -175.97 35 4 ARG A 37 ? ? -90.13 52.43 36 4 GLU A 38 ? ? -177.49 -40.23 37 4 LYS A 43 ? ? -68.55 -75.61 38 4 PHE A 45 ? ? -177.14 132.95 39 4 GLU A 53 ? ? -149.98 -48.27 40 4 LEU A 62 ? ? -90.08 -75.08 41 4 ASN A 64 ? ? 174.19 -35.57 42 4 THR A 71 ? ? -138.67 -51.66 43 4 ILE A 72 ? ? 59.78 159.60 44 4 ARG A 73 ? ? -92.01 50.54 45 5 SER A 12 ? ? -150.25 66.34 46 5 ALA A 13 ? ? -73.49 -77.38 47 5 THR A 14 ? ? -173.11 -36.53 48 5 LYS A 27 ? ? 56.04 103.68 49 5 ASN A 30 ? ? -97.60 -96.30 50 5 VAL A 31 ? ? 66.58 88.96 51 5 GLU A 38 ? ? -160.25 -59.67 52 5 LYS A 43 ? ? -59.64 -74.68 53 5 PHE A 45 ? ? -172.10 145.55 54 5 LEU A 62 ? ? -90.07 -75.03 55 5 ASN A 64 ? ? 179.67 -38.56 56 5 MET A 68 ? ? -95.49 39.77 57 5 THR A 71 ? ? -134.93 -48.90 58 5 ILE A 72 ? ? 59.28 165.98 59 5 ARG A 73 ? ? -99.19 48.90 60 6 ARG A 2 ? ? -108.22 -169.26 61 6 SER A 12 ? ? -100.57 -71.64 62 6 ALA A 13 ? ? 76.39 141.43 63 6 LYS A 27 ? ? 42.33 98.99 64 6 GLU A 38 ? ? -172.06 -46.67 65 6 ASN A 64 ? ? -178.63 -38.40 66 6 PHE A 67 ? ? -127.90 -167.95 67 6 MET A 68 ? ? -95.16 43.80 68 6 THR A 71 ? ? -141.07 -47.06 69 6 ILE A 72 ? ? 57.76 167.55 70 6 ARG A 73 ? ? -99.40 47.36 71 7 SER A 12 ? ? -170.99 76.30 72 7 THR A 14 ? ? 176.35 -31.47 73 7 TYR A 35 ? ? -115.63 -169.86 74 7 GLU A 38 ? ? -162.47 -48.54 75 7 LYS A 43 ? ? -178.23 135.60 76 7 GLU A 53 ? ? -138.61 -47.79 77 7 LEU A 62 ? ? -90.06 -75.29 78 7 ASN A 64 ? ? -179.14 -48.87 79 7 THR A 71 ? ? -140.96 -47.96 80 7 ILE A 72 ? ? 59.74 159.11 81 8 VAL A 10 ? ? -160.68 -168.43 82 8 SER A 12 ? ? -156.94 60.64 83 8 ALA A 13 ? ? -60.44 -77.91 84 8 THR A 14 ? ? -166.19 -31.85 85 8 ASN A 30 ? ? -174.70 145.87 86 8 GLU A 38 ? ? -157.79 -54.74 87 8 GLN A 51 ? ? -57.52 173.06 88 8 GLU A 52 ? ? -78.69 -152.54 89 8 GLU A 53 ? ? 67.49 -68.69 90 8 LEU A 62 ? ? -90.03 -69.60 91 8 ASN A 64 ? ? -177.59 -49.14 92 8 THR A 71 ? ? -135.57 -71.68 93 8 ILE A 72 ? ? 59.78 159.82 94 9 VAL A 10 ? ? -172.85 -168.91 95 9 SER A 12 ? ? -143.35 55.14 96 9 ALA A 13 ? ? -64.91 -72.98 97 9 THR A 14 ? ? -165.44 -41.44 98 9 ARG A 37 ? ? 70.09 36.05 99 9 GLU A 38 ? ? -175.19 -40.19 100 9 LYS A 43 ? ? -176.63 127.23 101 9 GLU A 53 ? ? -173.43 -49.41 102 9 LEU A 62 ? ? -75.21 -72.90 103 9 ASN A 64 ? ? -178.12 -67.38 104 9 THR A 71 ? ? -140.56 -55.69 105 9 ILE A 72 ? ? 59.79 160.37 106 9 THR A 75 ? ? -178.46 144.98 107 10 SER A 12 ? ? -157.18 57.64 108 10 THR A 14 ? ? -177.61 -36.51 109 10 TYR A 35 ? ? 58.83 171.61 110 10 ARG A 37 ? ? -99.68 40.53 111 10 GLU A 38 ? ? -170.82 -44.02 112 10 PRO A 42 ? ? -51.45 99.41 113 10 LYS A 43 ? ? -171.81 129.40 114 10 GLU A 49 ? ? -68.30 86.91 115 10 LEU A 62 ? ? -89.93 -75.08 116 10 ASN A 64 ? ? -178.58 -40.98 117 10 THR A 65 ? ? -162.85 -169.48 118 10 MET A 68 ? ? -94.16 46.44 119 10 THR A 71 ? ? -152.37 -45.97 120 10 ILE A 72 ? ? 61.60 161.40 121 10 ARG A 73 ? ? -94.25 43.38 122 11 ASN A 8 ? ? -177.50 62.41 123 11 THR A 14 ? ? 90.61 5.64 124 11 ARG A 37 ? ? -97.50 38.57 125 11 GLU A 38 ? ? -159.97 -45.29 126 11 LEU A 62 ? ? -90.11 -74.23 127 11 ASN A 64 ? ? -178.83 -38.82 128 11 PHE A 67 ? ? -124.71 -168.61 129 11 MET A 68 ? ? -95.04 44.46 130 11 THR A 71 ? ? -141.62 -53.93 131 11 ILE A 72 ? ? 59.92 159.21 132 12 ALA A 13 ? ? -68.13 -78.88 133 12 THR A 14 ? ? -177.43 -32.24 134 12 GLU A 38 ? ? 179.20 -40.34 135 12 PHE A 45 ? ? -178.49 -176.96 136 12 LEU A 62 ? ? -90.09 -74.95 137 12 ASN A 64 ? ? -178.57 -40.35 138 12 PHE A 67 ? ? -118.22 -168.83 139 12 MET A 68 ? ? -93.46 46.93 140 12 ILE A 72 ? ? 59.27 163.14 141 12 ARG A 73 ? ? -94.07 47.64 142 13 ASN A 3 ? ? 54.10 103.24 143 13 SER A 12 ? ? -157.26 67.47 144 13 THR A 14 ? ? -179.12 -24.93 145 13 VAL A 31 ? ? -172.11 120.32 146 13 GLU A 38 ? ? -137.67 -58.25 147 13 GLU A 53 ? ? -174.91 -53.44 148 13 LEU A 62 ? ? -89.97 -75.12 149 13 ASN A 64 ? ? -176.60 -41.18 150 13 PHE A 67 ? ? -109.16 -169.33 151 13 MET A 68 ? ? -98.38 31.57 152 13 ILE A 72 ? ? 60.15 159.16 153 13 ARG A 73 ? ? -90.71 51.60 154 14 SER A 12 ? ? -144.06 49.04 155 14 ALA A 13 ? ? -64.80 -76.10 156 14 THR A 14 ? ? -164.59 -37.16 157 14 GLU A 38 ? ? -165.61 -44.36 158 14 LYS A 43 ? ? -176.32 42.08 159 14 PHE A 45 ? ? 73.94 161.49 160 14 GLU A 53 ? ? -176.36 -49.37 161 14 LEU A 62 ? ? -90.05 -75.27 162 14 ASN A 64 ? ? 175.10 -36.62 163 14 THR A 71 ? ? -153.02 -51.09 164 14 ILE A 72 ? ? 64.65 160.91 165 14 ARG A 73 ? ? -92.40 48.68 166 15 ASN A 3 ? ? 59.03 114.82 167 15 VAL A 10 ? ? -170.32 -165.41 168 15 SER A 12 ? ? -163.72 52.66 169 15 THR A 14 ? ? -177.65 -32.12 170 15 LYS A 27 ? ? 57.01 110.87 171 15 ARG A 37 ? ? -96.94 41.36 172 15 GLU A 38 ? ? -162.56 -44.97 173 15 PHE A 45 ? ? -177.94 142.50 174 15 GLU A 52 ? ? -69.32 93.39 175 15 GLU A 53 ? ? -172.81 -49.68 176 15 LEU A 62 ? ? -76.02 -72.14 177 15 ASN A 64 ? ? -178.19 -39.54 178 15 THR A 65 ? ? -164.57 -169.73 179 15 MET A 68 ? ? -90.67 49.41 180 15 THR A 71 ? ? -155.27 -52.03 181 15 ILE A 72 ? ? 60.76 159.60 182 16 THR A 14 ? ? -161.65 -41.96 183 16 GLU A 38 ? ? -163.97 -59.09 184 16 LYS A 43 ? ? -177.61 137.03 185 16 GLU A 53 ? ? -139.76 -46.67 186 16 LEU A 62 ? ? -90.02 -71.21 187 16 ASN A 64 ? ? -177.18 -48.31 188 16 MET A 68 ? ? -90.09 51.53 189 16 ILE A 72 ? ? 57.73 166.02 190 16 ARG A 73 ? ? -91.10 48.84 191 17 SER A 12 ? ? -144.04 50.55 192 17 THR A 14 ? ? 179.47 -36.51 193 17 LYS A 27 ? ? 56.17 111.16 194 17 GLU A 38 ? ? -174.18 -41.02 195 17 PRO A 42 ? ? -54.25 109.46 196 17 GLU A 52 ? ? -68.24 93.31 197 17 GLU A 53 ? ? -169.53 -60.68 198 17 LEU A 62 ? ? -74.87 -72.26 199 17 ASN A 64 ? ? -177.38 -46.54 200 17 PHE A 67 ? ? -116.67 -164.87 201 17 MET A 68 ? ? -96.86 34.93 202 17 ILE A 72 ? ? 56.37 167.22 203 17 ARG A 73 ? ? -95.01 45.08 204 17 GLU A 76 ? ? -94.63 44.66 205 18 ASN A 8 ? ? -178.04 54.37 206 18 LEU A 9 ? ? -128.73 -168.82 207 18 VAL A 10 ? ? -178.55 -168.24 208 18 SER A 12 ? ? -167.66 76.43 209 18 ALA A 13 ? ? -97.62 -63.30 210 18 THR A 14 ? ? -163.61 -19.09 211 18 GLU A 38 ? ? -144.46 -57.41 212 18 LEU A 62 ? ? -85.39 -75.01 213 18 ASN A 64 ? ? 179.10 -38.52 214 18 PHE A 67 ? ? -115.20 -165.54 215 18 MET A 68 ? ? -97.10 36.19 216 18 THR A 71 ? ? -140.82 -56.38 217 18 ILE A 72 ? ? 59.97 159.96 218 18 THR A 75 ? ? -178.12 147.89 219 19 SER A 12 ? ? -154.07 75.05 220 19 THR A 14 ? ? -165.50 -34.40 221 19 GLU A 38 ? ? -156.44 -46.65 222 19 LYS A 43 ? ? -170.50 37.98 223 19 PHE A 45 ? ? 72.41 166.05 224 19 LEU A 62 ? ? -73.20 -74.24 225 19 ASN A 64 ? ? 179.51 -38.78 226 19 MET A 68 ? ? -93.12 45.68 227 19 THR A 71 ? ? -135.37 -48.86 228 19 ILE A 72 ? ? 55.26 174.61 229 19 ARG A 73 ? ? -104.78 66.16 230 20 SER A 12 ? ? -145.76 58.79 231 20 THR A 14 ? ? 176.03 -32.21 232 20 ARG A 37 ? ? -92.14 50.71 233 20 GLU A 38 ? ? -171.65 -42.28 234 20 GLU A 52 ? ? -74.72 -159.00 235 20 GLU A 53 ? ? 66.05 -71.58 236 20 LEU A 62 ? ? -72.01 -70.79 237 20 ASN A 64 ? ? -179.98 -67.40 238 20 MET A 68 ? ? -96.02 36.83 239 20 THR A 71 ? ? -134.02 -60.99 240 20 ILE A 72 ? ? 59.76 159.57 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KI2 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KI2 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '1mM [U-98% 13C; U-98% 15N] HP0827-1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component HP0827-1 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-98% 13C; U-98% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HN(COCA)CB' 1 2 1 '3D HCACO' 1 3 1 '3D 1H-13C NOESY' 1 4 1 '3D 1H-15N NOESY' 1 5 1 '3D HNHA' 1 6 1 '3D C(CO)NH' 1 7 1 '3D HNCO' 1 8 1 '3D HNCA' 1 9 1 '3D HNCACB' 1 10 1 '3D HBHA(CO)NH' 1 11 1 '3D HN(CO)CA' 1 12 1 '3D H(CCO)NH' 1 13 1 '3D HCCH-TOCSY' 1 14 1 '2D 1H-15N HSQC' 1 15 1 '2D 1H-13C HSQC' 1 16 1 '2D 1H-1H TOCSY' 1 17 1 '2D 1H-1H NOESY' 1 18 1 '3D CBCA(CO)NH' # _pdbx_nmr_refine.entry_id 2KI2 _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges, Read' 'structure solution' CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges, Read' refinement CNS ? 2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 78 ? A ASN 78 2 1 Y 1 A PRO 79 ? A PRO 79 3 1 Y 1 A LYS 80 ? A LYS 80 4 1 Y 1 A LYS 81 ? A LYS 81 5 1 Y 1 A SER 82 ? A SER 82 6 1 Y 1 A LEU 83 ? A LEU 83 7 1 Y 1 A GLU 84 ? A GLU 84 8 1 Y 1 A HIS 85 ? A HIS 85 9 1 Y 1 A HIS 86 ? A HIS 86 10 1 Y 1 A HIS 87 ? A HIS 87 11 1 Y 1 A HIS 88 ? A HIS 88 12 1 Y 1 A HIS 89 ? A HIS 89 13 1 Y 1 A HIS 90 ? A HIS 90 14 2 Y 1 A ASN 78 ? A ASN 78 15 2 Y 1 A PRO 79 ? A PRO 79 16 2 Y 1 A LYS 80 ? A LYS 80 17 2 Y 1 A LYS 81 ? A LYS 81 18 2 Y 1 A SER 82 ? A SER 82 19 2 Y 1 A LEU 83 ? A LEU 83 20 2 Y 1 A GLU 84 ? A GLU 84 21 2 Y 1 A HIS 85 ? A HIS 85 22 2 Y 1 A HIS 86 ? A HIS 86 23 2 Y 1 A HIS 87 ? A HIS 87 24 2 Y 1 A HIS 88 ? A HIS 88 25 2 Y 1 A HIS 89 ? A HIS 89 26 2 Y 1 A HIS 90 ? A HIS 90 27 3 Y 1 A ASN 78 ? A ASN 78 28 3 Y 1 A PRO 79 ? A PRO 79 29 3 Y 1 A LYS 80 ? A LYS 80 30 3 Y 1 A LYS 81 ? A LYS 81 31 3 Y 1 A SER 82 ? A SER 82 32 3 Y 1 A LEU 83 ? A LEU 83 33 3 Y 1 A GLU 84 ? A GLU 84 34 3 Y 1 A HIS 85 ? A HIS 85 35 3 Y 1 A HIS 86 ? A HIS 86 36 3 Y 1 A HIS 87 ? A HIS 87 37 3 Y 1 A HIS 88 ? A HIS 88 38 3 Y 1 A HIS 89 ? A HIS 89 39 3 Y 1 A HIS 90 ? A HIS 90 40 4 Y 1 A ASN 78 ? A ASN 78 41 4 Y 1 A PRO 79 ? A PRO 79 42 4 Y 1 A LYS 80 ? A LYS 80 43 4 Y 1 A LYS 81 ? A LYS 81 44 4 Y 1 A SER 82 ? A SER 82 45 4 Y 1 A LEU 83 ? A LEU 83 46 4 Y 1 A GLU 84 ? A GLU 84 47 4 Y 1 A HIS 85 ? A HIS 85 48 4 Y 1 A HIS 86 ? A HIS 86 49 4 Y 1 A HIS 87 ? A HIS 87 50 4 Y 1 A HIS 88 ? A HIS 88 51 4 Y 1 A HIS 89 ? A HIS 89 52 4 Y 1 A HIS 90 ? A HIS 90 53 5 Y 1 A ASN 78 ? A ASN 78 54 5 Y 1 A PRO 79 ? A PRO 79 55 5 Y 1 A LYS 80 ? A LYS 80 56 5 Y 1 A LYS 81 ? A LYS 81 57 5 Y 1 A SER 82 ? A SER 82 58 5 Y 1 A LEU 83 ? A LEU 83 59 5 Y 1 A GLU 84 ? A GLU 84 60 5 Y 1 A HIS 85 ? A HIS 85 61 5 Y 1 A HIS 86 ? A HIS 86 62 5 Y 1 A HIS 87 ? A HIS 87 63 5 Y 1 A HIS 88 ? A HIS 88 64 5 Y 1 A HIS 89 ? A HIS 89 65 5 Y 1 A HIS 90 ? A HIS 90 66 6 Y 1 A ASN 78 ? A ASN 78 67 6 Y 1 A PRO 79 ? A PRO 79 68 6 Y 1 A LYS 80 ? A LYS 80 69 6 Y 1 A LYS 81 ? A LYS 81 70 6 Y 1 A SER 82 ? A SER 82 71 6 Y 1 A LEU 83 ? A LEU 83 72 6 Y 1 A GLU 84 ? A GLU 84 73 6 Y 1 A HIS 85 ? A HIS 85 74 6 Y 1 A HIS 86 ? A HIS 86 75 6 Y 1 A HIS 87 ? A HIS 87 76 6 Y 1 A HIS 88 ? A HIS 88 77 6 Y 1 A HIS 89 ? A HIS 89 78 6 Y 1 A HIS 90 ? A HIS 90 79 7 Y 1 A ASN 78 ? A ASN 78 80 7 Y 1 A PRO 79 ? A PRO 79 81 7 Y 1 A LYS 80 ? A LYS 80 82 7 Y 1 A LYS 81 ? A LYS 81 83 7 Y 1 A SER 82 ? A SER 82 84 7 Y 1 A LEU 83 ? A LEU 83 85 7 Y 1 A GLU 84 ? A GLU 84 86 7 Y 1 A HIS 85 ? A HIS 85 87 7 Y 1 A HIS 86 ? A HIS 86 88 7 Y 1 A HIS 87 ? A HIS 87 89 7 Y 1 A HIS 88 ? A HIS 88 90 7 Y 1 A HIS 89 ? A HIS 89 91 7 Y 1 A HIS 90 ? A HIS 90 92 8 Y 1 A ASN 78 ? A ASN 78 93 8 Y 1 A PRO 79 ? A PRO 79 94 8 Y 1 A LYS 80 ? A LYS 80 95 8 Y 1 A LYS 81 ? A LYS 81 96 8 Y 1 A SER 82 ? A SER 82 97 8 Y 1 A LEU 83 ? A LEU 83 98 8 Y 1 A GLU 84 ? A GLU 84 99 8 Y 1 A HIS 85 ? A HIS 85 100 8 Y 1 A HIS 86 ? A HIS 86 101 8 Y 1 A HIS 87 ? A HIS 87 102 8 Y 1 A HIS 88 ? A HIS 88 103 8 Y 1 A HIS 89 ? A HIS 89 104 8 Y 1 A HIS 90 ? A HIS 90 105 9 Y 1 A ASN 78 ? A ASN 78 106 9 Y 1 A PRO 79 ? A PRO 79 107 9 Y 1 A LYS 80 ? A LYS 80 108 9 Y 1 A LYS 81 ? A LYS 81 109 9 Y 1 A SER 82 ? A SER 82 110 9 Y 1 A LEU 83 ? A LEU 83 111 9 Y 1 A GLU 84 ? A GLU 84 112 9 Y 1 A HIS 85 ? A HIS 85 113 9 Y 1 A HIS 86 ? A HIS 86 114 9 Y 1 A HIS 87 ? A HIS 87 115 9 Y 1 A HIS 88 ? A HIS 88 116 9 Y 1 A HIS 89 ? A HIS 89 117 9 Y 1 A HIS 90 ? A HIS 90 118 10 Y 1 A ASN 78 ? A ASN 78 119 10 Y 1 A PRO 79 ? A PRO 79 120 10 Y 1 A LYS 80 ? A LYS 80 121 10 Y 1 A LYS 81 ? A LYS 81 122 10 Y 1 A SER 82 ? A SER 82 123 10 Y 1 A LEU 83 ? A LEU 83 124 10 Y 1 A GLU 84 ? A GLU 84 125 10 Y 1 A HIS 85 ? A HIS 85 126 10 Y 1 A HIS 86 ? A HIS 86 127 10 Y 1 A HIS 87 ? A HIS 87 128 10 Y 1 A HIS 88 ? A HIS 88 129 10 Y 1 A HIS 89 ? A HIS 89 130 10 Y 1 A HIS 90 ? A HIS 90 131 11 Y 1 A ASN 78 ? A ASN 78 132 11 Y 1 A PRO 79 ? A PRO 79 133 11 Y 1 A LYS 80 ? A LYS 80 134 11 Y 1 A LYS 81 ? A LYS 81 135 11 Y 1 A SER 82 ? A SER 82 136 11 Y 1 A LEU 83 ? A LEU 83 137 11 Y 1 A GLU 84 ? A GLU 84 138 11 Y 1 A HIS 85 ? A HIS 85 139 11 Y 1 A HIS 86 ? A HIS 86 140 11 Y 1 A HIS 87 ? A HIS 87 141 11 Y 1 A HIS 88 ? A HIS 88 142 11 Y 1 A HIS 89 ? A HIS 89 143 11 Y 1 A HIS 90 ? A HIS 90 144 12 Y 1 A ASN 78 ? A ASN 78 145 12 Y 1 A PRO 79 ? A PRO 79 146 12 Y 1 A LYS 80 ? A LYS 80 147 12 Y 1 A LYS 81 ? A LYS 81 148 12 Y 1 A SER 82 ? A SER 82 149 12 Y 1 A LEU 83 ? A LEU 83 150 12 Y 1 A GLU 84 ? A GLU 84 151 12 Y 1 A HIS 85 ? A HIS 85 152 12 Y 1 A HIS 86 ? A HIS 86 153 12 Y 1 A HIS 87 ? A HIS 87 154 12 Y 1 A HIS 88 ? A HIS 88 155 12 Y 1 A HIS 89 ? A HIS 89 156 12 Y 1 A HIS 90 ? A HIS 90 157 13 Y 1 A ASN 78 ? A ASN 78 158 13 Y 1 A PRO 79 ? A PRO 79 159 13 Y 1 A LYS 80 ? A LYS 80 160 13 Y 1 A LYS 81 ? A LYS 81 161 13 Y 1 A SER 82 ? A SER 82 162 13 Y 1 A LEU 83 ? A LEU 83 163 13 Y 1 A GLU 84 ? A GLU 84 164 13 Y 1 A HIS 85 ? A HIS 85 165 13 Y 1 A HIS 86 ? A HIS 86 166 13 Y 1 A HIS 87 ? A HIS 87 167 13 Y 1 A HIS 88 ? A HIS 88 168 13 Y 1 A HIS 89 ? A HIS 89 169 13 Y 1 A HIS 90 ? A HIS 90 170 14 Y 1 A ASN 78 ? A ASN 78 171 14 Y 1 A PRO 79 ? A PRO 79 172 14 Y 1 A LYS 80 ? A LYS 80 173 14 Y 1 A LYS 81 ? A LYS 81 174 14 Y 1 A SER 82 ? A SER 82 175 14 Y 1 A LEU 83 ? A LEU 83 176 14 Y 1 A GLU 84 ? A GLU 84 177 14 Y 1 A HIS 85 ? A HIS 85 178 14 Y 1 A HIS 86 ? A HIS 86 179 14 Y 1 A HIS 87 ? A HIS 87 180 14 Y 1 A HIS 88 ? A HIS 88 181 14 Y 1 A HIS 89 ? A HIS 89 182 14 Y 1 A HIS 90 ? A HIS 90 183 15 Y 1 A ASN 78 ? A ASN 78 184 15 Y 1 A PRO 79 ? A PRO 79 185 15 Y 1 A LYS 80 ? A LYS 80 186 15 Y 1 A LYS 81 ? A LYS 81 187 15 Y 1 A SER 82 ? A SER 82 188 15 Y 1 A LEU 83 ? A LEU 83 189 15 Y 1 A GLU 84 ? A GLU 84 190 15 Y 1 A HIS 85 ? A HIS 85 191 15 Y 1 A HIS 86 ? A HIS 86 192 15 Y 1 A HIS 87 ? A HIS 87 193 15 Y 1 A HIS 88 ? A HIS 88 194 15 Y 1 A HIS 89 ? A HIS 89 195 15 Y 1 A HIS 90 ? A HIS 90 196 16 Y 1 A ASN 78 ? A ASN 78 197 16 Y 1 A PRO 79 ? A PRO 79 198 16 Y 1 A LYS 80 ? A LYS 80 199 16 Y 1 A LYS 81 ? A LYS 81 200 16 Y 1 A SER 82 ? A SER 82 201 16 Y 1 A LEU 83 ? A LEU 83 202 16 Y 1 A GLU 84 ? A GLU 84 203 16 Y 1 A HIS 85 ? A HIS 85 204 16 Y 1 A HIS 86 ? A HIS 86 205 16 Y 1 A HIS 87 ? A HIS 87 206 16 Y 1 A HIS 88 ? A HIS 88 207 16 Y 1 A HIS 89 ? A HIS 89 208 16 Y 1 A HIS 90 ? A HIS 90 209 17 Y 1 A ASN 78 ? A ASN 78 210 17 Y 1 A PRO 79 ? A PRO 79 211 17 Y 1 A LYS 80 ? A LYS 80 212 17 Y 1 A LYS 81 ? A LYS 81 213 17 Y 1 A SER 82 ? A SER 82 214 17 Y 1 A LEU 83 ? A LEU 83 215 17 Y 1 A GLU 84 ? A GLU 84 216 17 Y 1 A HIS 85 ? A HIS 85 217 17 Y 1 A HIS 86 ? A HIS 86 218 17 Y 1 A HIS 87 ? A HIS 87 219 17 Y 1 A HIS 88 ? A HIS 88 220 17 Y 1 A HIS 89 ? A HIS 89 221 17 Y 1 A HIS 90 ? A HIS 90 222 18 Y 1 A ASN 78 ? A ASN 78 223 18 Y 1 A PRO 79 ? A PRO 79 224 18 Y 1 A LYS 80 ? A LYS 80 225 18 Y 1 A LYS 81 ? A LYS 81 226 18 Y 1 A SER 82 ? A SER 82 227 18 Y 1 A LEU 83 ? A LEU 83 228 18 Y 1 A GLU 84 ? A GLU 84 229 18 Y 1 A HIS 85 ? A HIS 85 230 18 Y 1 A HIS 86 ? A HIS 86 231 18 Y 1 A HIS 87 ? A HIS 87 232 18 Y 1 A HIS 88 ? A HIS 88 233 18 Y 1 A HIS 89 ? A HIS 89 234 18 Y 1 A HIS 90 ? A HIS 90 235 19 Y 1 A ASN 78 ? A ASN 78 236 19 Y 1 A PRO 79 ? A PRO 79 237 19 Y 1 A LYS 80 ? A LYS 80 238 19 Y 1 A LYS 81 ? A LYS 81 239 19 Y 1 A SER 82 ? A SER 82 240 19 Y 1 A LEU 83 ? A LEU 83 241 19 Y 1 A GLU 84 ? A GLU 84 242 19 Y 1 A HIS 85 ? A HIS 85 243 19 Y 1 A HIS 86 ? A HIS 86 244 19 Y 1 A HIS 87 ? A HIS 87 245 19 Y 1 A HIS 88 ? A HIS 88 246 19 Y 1 A HIS 89 ? A HIS 89 247 19 Y 1 A HIS 90 ? A HIS 90 248 20 Y 1 A ASN 78 ? A ASN 78 249 20 Y 1 A PRO 79 ? A PRO 79 250 20 Y 1 A LYS 80 ? A LYS 80 251 20 Y 1 A LYS 81 ? A LYS 81 252 20 Y 1 A SER 82 ? A SER 82 253 20 Y 1 A LEU 83 ? A LEU 83 254 20 Y 1 A GLU 84 ? A GLU 84 255 20 Y 1 A HIS 85 ? A HIS 85 256 20 Y 1 A HIS 86 ? A HIS 86 257 20 Y 1 A HIS 87 ? A HIS 87 258 20 Y 1 A HIS 88 ? A HIS 88 259 20 Y 1 A HIS 89 ? A HIS 89 260 20 Y 1 A HIS 90 ? A HIS 90 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2KI2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_