data_2KJ9 # _entry.id 2KJ9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KJ9 pdb_00002kj9 10.2210/pdb2kj9/pdb RCSB RCSB101188 ? ? WWPDB D_1000101188 ? ? BMRB 16316 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details TargetDB EwR217E unspecified . BMRB 16316 unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KJ9 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-05-25 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cort, J.R.' 1 'Ramelot, T.A.' 2 'Wang, D.' 3 'Ciccosanti, C.' 4 'Janjua, H.' 5 'Nair, R.' 6 'Rost, B.' 7 'Swapna, G.' 8 'Acton, T.B.' 9 'Xiao, R.' 10 'Everett, J.K.' 11 'Montelione, G.T.' 12 'Kennedy, M.A.' 13 'Northeast Structural Genomics Consortium (NESG)' 14 # _citation.id primary _citation.title 'NMR structure of IntB phage-integrase-like protein fragment 90-199 from Erwinia carotova subsp. atroseptica' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cort, J.R.' 1 ? primary 'Montelione, G.T.' 2 ? primary 'Kennedy, M.A.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Integrase _entity.formula_weight 13959.003 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KSVQEKRNNTRAFKTVAKSWFATKTTWSEDYQRSVWTRLETYLFPDIGNKDIAELDTGDLLVPIKKIEKLGYLEIAMRVK QYATAIMRYAVQQKMIRFNPAYDLEGAVQKLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;KSVQEKRNNTRAFKTVAKSWFATKTTWSEDYQRSVWTRLETYLFPDIGNKDIAELDTGDLLVPIKKIEKLGYLEIAMRVK QYATAIMRYAVQQKMIRFNPAYDLEGAVQKLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier EwR217E # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 SER n 1 3 VAL n 1 4 GLN n 1 5 GLU n 1 6 LYS n 1 7 ARG n 1 8 ASN n 1 9 ASN n 1 10 THR n 1 11 ARG n 1 12 ALA n 1 13 PHE n 1 14 LYS n 1 15 THR n 1 16 VAL n 1 17 ALA n 1 18 LYS n 1 19 SER n 1 20 TRP n 1 21 PHE n 1 22 ALA n 1 23 THR n 1 24 LYS n 1 25 THR n 1 26 THR n 1 27 TRP n 1 28 SER n 1 29 GLU n 1 30 ASP n 1 31 TYR n 1 32 GLN n 1 33 ARG n 1 34 SER n 1 35 VAL n 1 36 TRP n 1 37 THR n 1 38 ARG n 1 39 LEU n 1 40 GLU n 1 41 THR n 1 42 TYR n 1 43 LEU n 1 44 PHE n 1 45 PRO n 1 46 ASP n 1 47 ILE n 1 48 GLY n 1 49 ASN n 1 50 LYS n 1 51 ASP n 1 52 ILE n 1 53 ALA n 1 54 GLU n 1 55 LEU n 1 56 ASP n 1 57 THR n 1 58 GLY n 1 59 ASP n 1 60 LEU n 1 61 LEU n 1 62 VAL n 1 63 PRO n 1 64 ILE n 1 65 LYS n 1 66 LYS n 1 67 ILE n 1 68 GLU n 1 69 LYS n 1 70 LEU n 1 71 GLY n 1 72 TYR n 1 73 LEU n 1 74 GLU n 1 75 ILE n 1 76 ALA n 1 77 MET n 1 78 ARG n 1 79 VAL n 1 80 LYS n 1 81 GLN n 1 82 TYR n 1 83 ALA n 1 84 THR n 1 85 ALA n 1 86 ILE n 1 87 MET n 1 88 ARG n 1 89 TYR n 1 90 ALA n 1 91 VAL n 1 92 GLN n 1 93 GLN n 1 94 LYS n 1 95 MET n 1 96 ILE n 1 97 ARG n 1 98 PHE n 1 99 ASN n 1 100 PRO n 1 101 ALA n 1 102 TYR n 1 103 ASP n 1 104 LEU n 1 105 GLU n 1 106 GLY n 1 107 ALA n 1 108 VAL n 1 109 GLN n 1 110 LYS n 1 111 LEU n 1 112 GLU n 1 113 HIS n 1 114 HIS n 1 115 HIS n 1 116 HIS n 1 117 HIS n 1 118 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ECA2889, intB, intB/ECA2889' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pectobacterium atrosepticum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 29471 _entity_src_gen.pdbx_gene_src_variant 'subsp. atroseptica' _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain K12 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET21-23C _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6D355_ERWCT _struct_ref.pdbx_db_accession Q6D355 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KSVQEKRNNTRAFKTVAKSWFATKTTWSEDYQRSVWTRLETYLFPDIGNKDIAELDTGDLLVPIKKIEKLGYLEIAMRVK QYATAIMRYAVQQKMIRFNPAYDLEGAVQK ; _struct_ref.pdbx_align_begin 90 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KJ9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 110 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6D355 _struct_ref_seq.db_align_beg 90 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 199 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 110 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KJ9 LEU A 111 ? UNP Q6D355 ? ? 'expression tag' 111 1 1 2KJ9 GLU A 112 ? UNP Q6D355 ? ? 'expression tag' 112 2 1 2KJ9 HIS A 113 ? UNP Q6D355 ? ? 'expression tag' 113 3 1 2KJ9 HIS A 114 ? UNP Q6D355 ? ? 'expression tag' 114 4 1 2KJ9 HIS A 115 ? UNP Q6D355 ? ? 'expression tag' 115 5 1 2KJ9 HIS A 116 ? UNP Q6D355 ? ? 'expression tag' 116 6 1 2KJ9 HIS A 117 ? UNP Q6D355 ? ? 'expression tag' 117 7 1 2KJ9 HIS A 118 ? UNP Q6D355 ? ? 'expression tag' 118 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' 1 3 1 '3D HNCO' 1 4 1 '3D HNCA' 1 5 1 '3D HN(CO)CA' 1 6 1 '3D CBCA(CO)NH' 1 7 1 '3D HNCACB' 1 8 1 '3D HBHA(CO)NH' 1 9 1 '3D C(CO)NH' 1 10 1 '3D HCCH-TOCSY' 1 11 1 '3D HNHA' 1 12 1 '2D 1H-15N HSQC' 1 13 2 '2D 1H-13C HSQC' 1 14 3 '4D 1H-13C-13C-1H HMQC-NOESY-HMQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 215 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1 mM [U-99% 13C; U-99% 15N] protein, 20 mM MES, 200 mM sodium chloride, 5 mM calcium chloride, 0.02 w/v sodium azide, 95 % H2O, 5 % [U-99% 2H] D2O, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;0.7 mM [5% biosynthetically directed 13C; U-99% 15N] protein, 20 mM MES, 200 mM sodium chloride, 5 mM calcium chloride, 0.02 w/v sodium azide, 95 % H2O, 5 % [U-99% 2H] D2O, 95% H2O/5% D2O ; 2 '95% H2O/5% D2O' ;0.7 mM [U-99% 13C; U-99% 15N] protein, 20 mM MES, 200 mM sodium chloride, 5 mM calcium chloride, 0.02 w/v sodium azide, 100 % [U-99% 2H] D2O-20, 100% D2O ; 3 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 750 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KJ9 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with low energies and few restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KJ9 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KJ9 _pdbx_nmr_representative.selection_criteria 'no criteria' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Huang, Tejero, Powers and Montelione' 'structure solution' AutoStructure ? 1 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 2 Goddard 'data analysis' Sparky ? 3 Goddard 'chemical shift assignment' Sparky ? 4 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 5 'Accelrys Software Inc.' processing Felix ? 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'structure of fragment representing residues 90-199 of the full length protein (428 amino acids)' _exptl.entry_id 2KJ9 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KJ9 _struct.title ;NMR structure of IntB phage-integrase-like protein fragment 90-199 from Erwinia carotova subsp. atroseptica: Northeast Structural Genomics Consortium target EwR217E ; _struct.pdbx_model_details 'no criteria, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KJ9 _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text ;integrase, DNA_BRE_C superfamily, bacteriophage P4 integrase, intB, Integrase-like_cat-core_phage, PSI-2, Structural Genomics, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, DNA BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 12 ? THR A 23 ? ALA A 12 THR A 23 1 ? 12 HELX_P HELX_P2 2 SER A 28 ? TYR A 42 ? SER A 28 TYR A 42 1 ? 15 HELX_P HELX_P3 3 ASP A 46 ? LYS A 50 ? ASP A 46 LYS A 50 5 ? 5 HELX_P HELX_P4 4 ASP A 51 ? LEU A 55 ? ASP A 51 LEU A 55 5 ? 5 HELX_P HELX_P5 5 ASP A 56 ? LYS A 69 ? ASP A 56 LYS A 69 1 ? 14 HELX_P HELX_P6 6 TYR A 72 ? GLN A 93 ? TYR A 72 GLN A 93 1 ? 22 HELX_P HELX_P7 7 ASN A 99 ? LEU A 104 ? ASN A 99 LEU A 104 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2KJ9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 HIS 118 118 118 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-07-07 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1 ? mM '[U-99% 13C; U-99% 15N]' 1 MES-2 20 ? mM ? 1 'sodium chloride-3' 200 ? mM ? 1 'calcium chloride-4' 5 ? mM ? 1 'sodium azide-5' 0.02 ? w/v ? 1 H2O-6 95 ? % ? 1 D2O-7 5 ? % '[U-99% 2H]' 1 entity-8 0.7 ? mM '[5% biosynthetically directed 13C; U-99% 15N]' 2 MES-9 20 ? mM ? 2 'sodium chloride-10' 200 ? mM ? 2 'calcium chloride-11' 5 ? mM ? 2 'sodium azide-12' 0.02 ? w/v ? 2 H2O-13 95 ? % ? 2 D2O-14 5 ? % '[U-99% 2H]' 2 entity-15 0.7 ? mM '[U-99% 13C; U-99% 15N]' 3 MES-16 20 ? mM ? 3 'sodium chloride-17' 200 ? mM ? 3 'calcium chloride-18' 5 ? mM ? 3 'sodium azide-19' 0.02 ? w/v ? 3 D2O-20 100 ? % '[U-99% 2H]' 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 OE2 A GLU 68 ? ? HZ2 A LYS 110 ? ? 1.55 2 6 HZ2 A LYS 50 ? ? OD2 A ASP 59 ? ? 1.58 3 7 H A PHE 44 ? ? HD2 A PRO 45 ? ? 1.33 4 13 HG A SER 28 ? ? OD1 A ASP 30 ? ? 1.54 5 13 HZ1 A LYS 50 ? ? OD2 A ASP 59 ? ? 1.57 6 13 OD1 A ASP 46 ? ? HZ2 A LYS 50 ? ? 1.58 7 16 HZ3 A LYS 50 ? ? OE2 A GLU 54 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 3 GLU A 5 ? ? -77.45 22.88 2 3 ILE A 52 ? ? 73.19 -44.08 3 3 LEU A 111 ? ? -113.75 56.73 4 4 ARG A 11 ? ? -95.89 34.18 5 4 ILE A 52 ? ? 73.03 -47.40 6 4 TYR A 72 ? ? -100.06 79.63 7 4 GLU A 105 ? ? 66.29 -56.40 8 5 ARG A 11 ? ? -77.26 35.94 9 5 PHE A 98 ? ? 70.77 165.71 10 5 ASP A 103 ? ? 63.57 97.94 11 5 ALA A 107 ? ? 63.30 -164.12 12 6 TYR A 42 ? ? -96.65 -61.38 13 6 ARG A 97 ? ? 72.25 -61.18 14 6 GLN A 109 ? ? 61.04 86.13 15 6 HIS A 116 ? ? -140.25 -8.62 16 7 LEU A 43 ? ? -101.13 55.78 17 7 PHE A 44 ? ? -144.43 -48.19 18 7 ILE A 52 ? ? 72.50 -42.79 19 7 GLU A 105 ? ? 65.30 -83.73 20 8 ASN A 8 ? ? 59.08 71.03 21 8 THR A 25 ? ? -84.91 49.97 22 8 PHE A 44 ? ? -132.95 -49.40 23 8 ASN A 49 ? ? 46.32 25.42 24 8 ASP A 51 ? ? 63.17 -124.32 25 8 ILE A 52 ? ? -175.40 -32.03 26 8 LEU A 55 ? ? -67.56 95.02 27 8 GLU A 105 ? ? 72.59 -58.77 28 9 PHE A 44 ? ? 101.84 -38.72 29 9 ASP A 46 ? ? -88.92 -70.02 30 9 HIS A 116 ? ? 67.73 -76.68 31 9 HIS A 117 ? ? 175.31 -29.12 32 10 MET A 95 ? ? -90.61 -71.92 33 10 ASP A 103 ? ? -167.98 106.02 34 10 GLU A 105 ? ? 66.39 -61.43 35 10 ALA A 107 ? ? -90.79 -61.90 36 11 THR A 25 ? ? -140.77 18.72 37 11 ILE A 52 ? ? 69.34 -44.30 38 11 GLU A 105 ? ? 67.63 -61.70 39 12 ASN A 8 ? ? 61.89 85.87 40 12 ASP A 46 ? ? -101.97 -64.49 41 12 ILE A 52 ? ? 72.78 -42.70 42 12 ARG A 97 ? ? 70.48 -64.64 43 13 GLN A 4 ? ? -64.88 -80.38 44 13 ASP A 46 ? ? -97.81 -61.02 45 13 ILE A 52 ? ? 71.11 -43.65 46 13 HIS A 114 ? ? -175.51 -28.34 47 14 GLU A 5 ? ? 57.02 -153.45 48 14 ARG A 11 ? ? -150.42 21.01 49 14 ASP A 46 ? ? -113.77 -73.39 50 14 ASN A 49 ? ? 173.30 -32.90 51 14 ASP A 103 ? ? 60.28 83.62 52 14 GLU A 112 ? ? 70.85 -51.56 53 15 PHE A 44 ? ? -123.82 -51.91 54 15 ILE A 52 ? ? 63.83 -43.95 55 15 LYS A 110 ? ? 61.86 -163.65 56 15 LEU A 111 ? ? -153.95 -32.13 57 15 HIS A 116 ? ? -115.42 75.48 58 15 HIS A 117 ? ? -139.65 -32.82 59 16 THR A 26 ? ? -121.11 -64.61 60 16 LEU A 43 ? ? -90.01 -66.72 61 16 ASP A 46 ? ? -101.45 -61.12 62 16 HIS A 116 ? ? -118.36 -166.24 63 17 LYS A 24 ? ? -95.80 36.69 64 17 THR A 25 ? ? -76.93 21.20 65 17 ASN A 99 ? ? -59.85 109.66 66 17 GLN A 109 ? ? -79.95 -167.47 67 18 ARG A 97 ? ? 71.23 -45.46 68 18 ASP A 103 ? ? -64.88 61.93 69 18 GLU A 105 ? ? 67.61 -67.59 70 18 HIS A 117 ? ? 65.72 90.30 71 19 GLN A 4 ? ? 56.88 78.02 72 19 ILE A 52 ? ? 73.99 -39.61 73 19 ASN A 99 ? ? -59.92 106.91 74 19 GLU A 112 ? ? 66.14 -78.98 75 20 THR A 26 ? ? -128.29 -58.08 76 20 ILE A 52 ? ? 73.54 -35.95 #