data_2KJA # _entry.id 2KJA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KJA pdb_00002kja 10.2210/pdb2kja/pdb RCSB RCSB101189 ? ? WWPDB D_1000101189 ? ? # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KJA _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2009-05-26 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Prochnicka-Chalufour, A.' 1 'Corzo, G.' 2 'Garcia, B.I.' 3 'Possani, L.D.' 4 'Delepierre, M.' 5 # _citation.id primary _citation.title ;Solution structure of Cn5, a crustacean toxin found in the venom of the scorpions Centruroides noxius and Centruroides suffusus suffusus. ; _citation.journal_abbrev Biochim.Biophys.Acta _citation.journal_volume 1794 _citation.page_first 1591 _citation.page_last 1598 _citation.year 2009 _citation.journal_id_ASTM BBACAQ _citation.country NE _citation.journal_id_ISSN 0006-3002 _citation.journal_id_CSD 0113 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19631296 _citation.pdbx_database_id_DOI 10.1016/j.bbapap.2009.07.006 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Corzo, G.' 1 ? primary 'Prochnicka-Chalufour, A.' 2 ? primary 'Garcia, B.I.' 3 ? primary 'Possani, L.D.' 4 ? primary 'Delepierre, M.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Beta-toxin Cn5' _entity.formula_weight 7152.128 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name CngtII # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KEGYLVNKSTGCKYGCLLLGKNEGCDKECKAKNQGGSYGYCYAFGCWCEGLPESTPTYPLPNKSCS _entity_poly.pdbx_seq_one_letter_code_can KEGYLVNKSTGCKYGCLLLGKNEGCDKECKAKNQGGSYGYCYAFGCWCEGLPESTPTYPLPNKSCS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 GLU n 1 3 GLY n 1 4 TYR n 1 5 LEU n 1 6 VAL n 1 7 ASN n 1 8 LYS n 1 9 SER n 1 10 THR n 1 11 GLY n 1 12 CYS n 1 13 LYS n 1 14 TYR n 1 15 GLY n 1 16 CYS n 1 17 LEU n 1 18 LEU n 1 19 LEU n 1 20 GLY n 1 21 LYS n 1 22 ASN n 1 23 GLU n 1 24 GLY n 1 25 CYS n 1 26 ASP n 1 27 LYS n 1 28 GLU n 1 29 CYS n 1 30 LYS n 1 31 ALA n 1 32 LYS n 1 33 ASN n 1 34 GLN n 1 35 GLY n 1 36 GLY n 1 37 SER n 1 38 TYR n 1 39 GLY n 1 40 TYR n 1 41 CYS n 1 42 TYR n 1 43 ALA n 1 44 PHE n 1 45 GLY n 1 46 CYS n 1 47 TRP n 1 48 CYS n 1 49 GLU n 1 50 GLY n 1 51 LEU n 1 52 PRO n 1 53 GLU n 1 54 SER n 1 55 THR n 1 56 PRO n 1 57 THR n 1 58 TYR n 1 59 PRO n 1 60 LEU n 1 61 PRO n 1 62 ASN n 1 63 LYS n 1 64 SER n 1 65 CYS n 1 66 SER n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'Mexican scorpion' _entity_src_nat.pdbx_organism_scientific 'Centruroides noxius' _entity_src_nat.pdbx_ncbi_taxonomy_id 6878 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SCX5_CENNO _struct_ref.pdbx_db_accession P45663 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KEGYLVNKSTGCKYGCLLLGKNEGCDKECKAKNQGGSYGYCYAFGCWCEGLPESTPTYPLPNKSCS _struct_ref.pdbx_align_begin 20 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KJA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P45663 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 85 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D 1H-1H COSY' 1 3 1 '2D 1H-1H NOESY' 1 4 2 '2D 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 10 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '2.4 mM toxin Cn5-1, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '2.4 mM toxin Cn5-2, 100% D2O' 2 '100% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KJA _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KJA _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KJA _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VnmrJ ? 1 'Johnson, One Moon Scientific' processing NMRView ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 3 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 2.2 4 ;Linge, O'Donoghue and Nilges ; refinement ARIA 2.2 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KJA _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KJA _struct.title 'Chemical shift assignments, constraints, and coordinates for CN5 scorpion toxin' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KJA _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text ;NMR solution structure, scorpion toxin, Centruroides noxius, Centruroides suffusus suffusus, Na +channel inhibitor, Disulfide bond, Ionic channel inhibitor, Neurotoxin, Secreted, Sodium channel inhibitor, Toxin ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 22 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 30 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 22 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 30 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 65 SG ? ? A CYS 12 A CYS 65 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 16 A CYS 41 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf3 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 25 A CYS 46 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf4 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 29 A CYS 48 1_555 ? ? ? ? ? ? ? 2.026 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 58 A . ? TYR 58 A PRO 59 A ? PRO 59 A 1 -2.66 2 TYR 58 A . ? TYR 58 A PRO 59 A ? PRO 59 A 2 -5.09 3 TYR 58 A . ? TYR 58 A PRO 59 A ? PRO 59 A 3 -4.82 4 TYR 58 A . ? TYR 58 A PRO 59 A ? PRO 59 A 4 -3.53 5 TYR 58 A . ? TYR 58 A PRO 59 A ? PRO 59 A 5 -4.46 6 TYR 58 A . ? TYR 58 A PRO 59 A ? PRO 59 A 6 -4.37 7 TYR 58 A . ? TYR 58 A PRO 59 A ? PRO 59 A 7 -3.99 8 TYR 58 A . ? TYR 58 A PRO 59 A ? PRO 59 A 8 -3.57 9 TYR 58 A . ? TYR 58 A PRO 59 A ? PRO 59 A 9 -3.74 10 TYR 58 A . ? TYR 58 A PRO 59 A ? PRO 59 A 10 -3.85 11 TYR 58 A . ? TYR 58 A PRO 59 A ? PRO 59 A 11 -5.28 12 TYR 58 A . ? TYR 58 A PRO 59 A ? PRO 59 A 12 -5.64 13 TYR 58 A . ? TYR 58 A PRO 59 A ? PRO 59 A 13 -4.36 14 TYR 58 A . ? TYR 58 A PRO 59 A ? PRO 59 A 14 -3.89 15 TYR 58 A . ? TYR 58 A PRO 59 A ? PRO 59 A 15 -4.23 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 3 ? TYR A 4 ? GLY A 3 TYR A 4 A 2 GLY A 45 ? GLU A 49 ? GLY A 45 GLU A 49 A 3 TYR A 38 ? TYR A 42 ? TYR A 38 TYR A 42 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 3 ? N GLY A 3 O CYS A 48 ? O CYS A 48 A 2 3 O GLU A 49 ? O GLU A 49 N TYR A 38 ? N TYR A 38 # _atom_sites.entry_id 2KJA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 SER 66 66 66 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-10-06 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'toxin Cn5-1' 2.4 ? mM ? 1 'toxin Cn5-2' 2.4 ? mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KJA _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 15 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 973 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 387 _pdbx_nmr_constraints.NOE_long_range_total_count 298 _pdbx_nmr_constraints.NOE_medium_range_total_count 89 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 199 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD22 A LEU 19 ? ? H A PHE 44 ? ? 1.34 2 2 H1 A LYS 1 ? ? OE2 A GLU 53 ? ? 1.54 3 7 O A CYS 25 ? ? H A CYS 29 ? ? 1.60 4 8 H A TYR 42 ? ? O A GLY 45 ? ? 1.59 5 14 HD21 A LEU 19 ? ? H A PHE 44 ? ? 1.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 8 ? ? -67.27 0.90 2 1 LEU A 17 ? ? -137.25 -38.94 3 1 ALA A 43 ? ? 39.12 48.37 4 1 CYS A 46 ? ? -69.38 94.12 5 2 GLN A 34 ? ? -70.10 -78.06 6 2 SER A 37 ? ? -85.96 -70.16 7 2 CYS A 46 ? ? -67.78 83.09 8 2 CYS A 65 ? ? -130.40 -153.99 9 3 GLN A 34 ? ? -74.92 -77.35 10 3 CYS A 65 ? ? -142.23 -57.65 11 4 LEU A 5 ? ? -69.96 92.82 12 4 LEU A 17 ? ? -138.31 -32.49 13 4 GLN A 34 ? ? -77.56 -77.22 14 4 CYS A 46 ? ? -67.69 96.03 15 4 ASN A 62 ? ? -94.09 -61.46 16 5 GLN A 34 ? ? -78.93 -82.39 17 5 TYR A 40 ? ? -127.76 -168.47 18 5 CYS A 46 ? ? -66.86 85.15 19 5 ASN A 62 ? ? -90.65 -60.75 20 6 CYS A 16 ? ? -108.32 -156.10 21 6 LEU A 17 ? ? -142.76 -0.39 22 6 LYS A 30 ? ? -107.15 47.56 23 6 GLN A 34 ? ? -66.57 -71.93 24 6 CYS A 46 ? ? -68.20 89.91 25 7 CYS A 16 ? ? -157.29 -158.31 26 7 CYS A 65 ? ? -151.73 -151.35 27 8 CYS A 16 ? ? -101.52 -156.54 28 8 LYS A 21 ? ? -69.72 99.58 29 8 GLN A 34 ? ? -68.55 -73.89 30 8 PHE A 44 ? ? 70.83 -27.85 31 8 CYS A 65 ? ? -151.43 69.88 32 9 LYS A 21 ? ? -64.45 92.26 33 9 GLN A 34 ? ? -87.39 -82.14 34 9 CYS A 46 ? ? -69.70 98.03 35 10 LYS A 8 ? ? -75.73 40.04 36 10 SER A 9 ? ? -148.37 -45.76 37 10 CYS A 16 ? ? -102.32 -159.37 38 10 LYS A 30 ? ? -149.14 32.41 39 11 LYS A 8 ? ? -77.37 41.42 40 11 SER A 9 ? ? -146.22 -56.33 41 11 CYS A 16 ? ? -102.92 -158.41 42 11 ALA A 31 ? ? -77.24 -168.63 43 11 GLN A 34 ? ? -96.72 56.86 44 11 TYR A 40 ? ? -127.27 -169.27 45 12 LEU A 5 ? ? -69.08 86.86 46 12 LYS A 21 ? ? -67.19 87.60 47 12 GLN A 34 ? ? -70.84 -71.15 48 12 CYS A 65 ? ? -107.73 74.70 49 13 CYS A 16 ? ? -146.43 -156.98 50 14 LYS A 8 ? ? -73.69 49.99 51 14 SER A 9 ? ? -157.52 -54.95 52 14 GLU A 28 ? ? -91.32 -62.25 53 14 ALA A 31 ? ? -66.73 -177.12 54 14 GLN A 34 ? ? -108.96 53.02 55 15 SER A 9 ? ? -136.11 -49.20 56 15 LEU A 17 ? ? -142.02 -13.79 57 15 ALA A 31 ? ? -73.31 -169.70 58 15 GLN A 34 ? ? -96.73 51.74 59 15 TYR A 40 ? ? -124.03 -166.57 60 15 ASN A 62 ? ? -90.61 -62.69 #