data_2KJF # _entry.id 2KJF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KJF pdb_00002kjf 10.2210/pdb2kjf/pdb RCSB RCSB101194 ? ? WWPDB D_1000101194 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-08-18 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_conn 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' pdbx_entry_details 8 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 5 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 6 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 7 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 8 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 9 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KJF _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-05-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Martin-Visscher, L.A.' 1 'Gong, X.' 2 'Duszyk, M.' 3 'Vederas, J.' 4 # _citation.id primary _citation.title 'The three-dimensional structure of carnocyclin A reveals that many circular bacteriocins share a common structural motif.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 284 _citation.page_first 28674 _citation.page_last 28681 _citation.year 2009 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19692336 _citation.pdbx_database_id_DOI 10.1074/jbc.M109.036459 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Martin-Visscher, L.A.' 1 ? primary 'Gong, X.' 2 ? primary 'Duszyk, M.' 3 ? primary 'Vederas, J.C.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description Carnocyclin-A _entity.formula_weight 5885.010 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSGVFTAVKAAIAKQGIKKAIQL _entity_poly.pdbx_seq_one_letter_code_can LVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSGVFTAVKAAIAKQGIKKAIQL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 VAL n 1 3 ALA n 1 4 TYR n 1 5 GLY n 1 6 ILE n 1 7 ALA n 1 8 GLN n 1 9 GLY n 1 10 THR n 1 11 ALA n 1 12 GLU n 1 13 LYS n 1 14 VAL n 1 15 VAL n 1 16 SER n 1 17 LEU n 1 18 ILE n 1 19 ASN n 1 20 ALA n 1 21 GLY n 1 22 LEU n 1 23 THR n 1 24 VAL n 1 25 GLY n 1 26 SER n 1 27 ILE n 1 28 ILE n 1 29 SER n 1 30 ILE n 1 31 LEU n 1 32 GLY n 1 33 GLY n 1 34 VAL n 1 35 THR n 1 36 VAL n 1 37 GLY n 1 38 LEU n 1 39 SER n 1 40 GLY n 1 41 VAL n 1 42 PHE n 1 43 THR n 1 44 ALA n 1 45 VAL n 1 46 LYS n 1 47 ALA n 1 48 ALA n 1 49 ILE n 1 50 ALA n 1 51 LYS n 1 52 GLN n 1 53 GLY n 1 54 ILE n 1 55 LYS n 1 56 LYS n 1 57 ALA n 1 58 ILE n 1 59 GLN n 1 60 LEU n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'Carnobacterium piscicola' _entity_src_nat.pdbx_organism_scientific 'Carnobacterium maltaromaticum' _entity_src_nat.pdbx_ncbi_taxonomy_id 2751 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain UAL307 _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 LEU 60 60 60 LEU LEU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KJF _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KJF _struct.title 'The solution structure of the circular bacteriocin carnocyclin A (CclA)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KJF _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' _struct_keywords.text 'circular bacteriocin, antimicrobial peptide, helical, saposin-fold, Antibiotic, Antimicrobial, Bacteriocin, ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CCLA_CARML _struct_ref.pdbx_db_accession B2MVM5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSGVFTAVKAAIAKQGIKKAIQL _struct_ref.pdbx_align_begin 5 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KJF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 60 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B2MVM5 _struct_ref_seq.db_align_beg 5 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 64 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 60 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 7 ? ASN A 19 ? ALA A 7 ASN A 19 1 ? 13 HELX_P HELX_P2 2 THR A 23 ? GLY A 32 ? THR A 23 GLY A 32 1 ? 10 HELX_P HELX_P3 3 LEU A 38 ? GLN A 52 ? LEU A 38 GLN A 52 1 ? 15 HELX_P HELX_P4 4 GLY A 53 ? LEU A 60 ? GLY A 53 LEU A 60 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id LEU _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id N _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id LEU _struct_conn.ptnr2_label_seq_id 60 _struct_conn.ptnr2_label_atom_id C _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id LEU _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id LEU _struct_conn.ptnr2_auth_seq_id 60 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.354 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id LEU _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 1 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id LEU _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 60 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id LEU _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 1 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id LEU _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 60 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom N _pdbx_modification_feature.modified_residue_id_linking_atom C _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Non-standard linkage' # _pdbx_entry_details.entry_id 2KJF _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 N A LEU 1 ? ? O A LEU 60 ? ? 2.15 2 2 N A LEU 1 ? ? O A LEU 60 ? ? 2.14 3 3 N A LEU 1 ? ? O A LEU 60 ? ? 2.14 4 4 N A LEU 1 ? ? O A LEU 60 ? ? 2.14 5 5 N A LEU 1 ? ? O A LEU 60 ? ? 2.14 6 6 N A LEU 1 ? ? O A LEU 60 ? ? 2.14 7 7 N A LEU 1 ? ? O A LEU 60 ? ? 2.15 8 8 N A LEU 1 ? ? O A LEU 60 ? ? 2.15 9 9 N A LEU 1 ? ? O A LEU 60 ? ? 2.15 10 10 N A LEU 1 ? ? O A LEU 60 ? ? 2.15 11 11 N A LEU 1 ? ? O A LEU 60 ? ? 2.16 12 12 N A LEU 1 ? ? O A LEU 60 ? ? 2.15 13 13 N A LEU 1 ? ? O A LEU 60 ? ? 2.14 14 14 N A LEU 1 ? ? O A LEU 60 ? ? 2.16 15 15 N A LEU 1 ? ? O A LEU 60 ? ? 2.14 16 16 N A LEU 1 ? ? O A LEU 60 ? ? 2.14 17 17 N A LEU 1 ? ? O A LEU 60 ? ? 2.15 18 18 N A LEU 1 ? ? O A LEU 60 ? ? 2.15 19 19 N A LEU 1 ? ? O A LEU 60 ? ? 2.14 20 20 N A LEU 1 ? ? O A LEU 60 ? ? 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 36 ? ? -56.05 99.94 2 1 GLN A 52 ? ? -137.45 -72.85 3 2 GLN A 52 ? ? -119.13 -71.01 4 3 GLN A 52 ? ? -130.19 -68.59 5 4 GLN A 52 ? ? -133.89 -67.79 6 5 GLN A 52 ? ? -135.92 -69.85 7 6 VAL A 36 ? ? -53.16 101.47 8 6 GLN A 52 ? ? -122.12 -72.83 9 7 VAL A 36 ? ? -54.95 100.75 10 7 GLN A 52 ? ? -136.81 -73.43 11 8 GLN A 52 ? ? -131.98 -74.35 12 9 VAL A 36 ? ? -51.21 102.25 13 9 GLN A 52 ? ? -124.08 -68.61 14 10 GLN A 52 ? ? -134.42 -64.50 15 11 VAL A 36 ? ? -57.70 98.79 16 11 GLN A 52 ? ? -122.35 -74.63 17 12 GLN A 52 ? ? -105.80 -63.89 18 13 VAL A 36 ? ? -55.04 100.61 19 13 GLN A 52 ? ? -108.17 -70.98 20 14 VAL A 36 ? ? 53.11 77.26 21 14 GLN A 52 ? ? -100.59 -74.96 22 15 GLN A 52 ? ? -122.13 -67.53 23 17 GLN A 52 ? ? -123.70 -69.50 24 18 VAL A 36 ? ? -55.10 100.45 25 18 GLN A 52 ? ? -130.65 -71.39 26 19 GLN A 52 ? ? -104.89 -67.63 27 20 GLN A 52 ? ? -111.17 -70.33 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KJF _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KJF _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-99% 13C; U-99% 15N] Carnocyclin A, 20 mM sodium phosphate, 1 mM EDTA, 1 mM sodium azide, 0.1 mM DSS, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-99% 13C; U-99% 15N] Carnocyclin A, 20 mM sodium phosphate, 1 mM EDTA, 1 mM sodium azide, 0.1 mM DSS, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Carnocyclin A' 1 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate' 20 ? mM ? 1 EDTA 1 ? mM ? 1 'sodium azide' 1 ? mM ? 1 DSS 0.1 ? mM ? 1 'Carnocyclin A' 1 ? mM '[U-99% 13C; U-99% 15N]' 2 'sodium phosphate' 20 ? mM ? 2 EDTA 1 ? mM ? 2 'sodium azide' 1 ? mM ? 2 DSS 0.1 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 5.9 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCO' 1 3 1 '3D HNCACB' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '3D 1H-15N TOCSY' 1 7 1 '3D HNHA' 1 8 2 '2D 1H-1H TOCSY' 1 9 2 '2D 1H-1H COSY' 1 10 2 '2D 1H-1H NOESY' 1 11 2 '2D 1H-13C HSQC' 1 12 2 '3D HCCH-TOCSY' 1 13 2 '3D 1H-13C NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KJF _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 657 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 209 _pdbx_nmr_constraints.NOE_long_range_total_count 125 _pdbx_nmr_constraints.NOE_medium_range_total_count 144 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 179 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2KJF _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, P. et al.' refinement CYANA 2.1 1 'Guntert, P. et al.' 'structure solution' CYANA 2.1 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 GLN N N N N 31 GLN CA C N S 32 GLN C C N N 33 GLN O O N N 34 GLN CB C N N 35 GLN CG C N N 36 GLN CD C N N 37 GLN OE1 O N N 38 GLN NE2 N N N 39 GLN OXT O N N 40 GLN H H N N 41 GLN H2 H N N 42 GLN HA H N N 43 GLN HB2 H N N 44 GLN HB3 H N N 45 GLN HG2 H N N 46 GLN HG3 H N N 47 GLN HE21 H N N 48 GLN HE22 H N N 49 GLN HXT H N N 50 GLU N N N N 51 GLU CA C N S 52 GLU C C N N 53 GLU O O N N 54 GLU CB C N N 55 GLU CG C N N 56 GLU CD C N N 57 GLU OE1 O N N 58 GLU OE2 O N N 59 GLU OXT O N N 60 GLU H H N N 61 GLU H2 H N N 62 GLU HA H N N 63 GLU HB2 H N N 64 GLU HB3 H N N 65 GLU HG2 H N N 66 GLU HG3 H N N 67 GLU HE2 H N N 68 GLU HXT H N N 69 GLY N N N N 70 GLY CA C N N 71 GLY C C N N 72 GLY O O N N 73 GLY OXT O N N 74 GLY H H N N 75 GLY H2 H N N 76 GLY HA2 H N N 77 GLY HA3 H N N 78 GLY HXT H N N 79 ILE N N N N 80 ILE CA C N S 81 ILE C C N N 82 ILE O O N N 83 ILE CB C N S 84 ILE CG1 C N N 85 ILE CG2 C N N 86 ILE CD1 C N N 87 ILE OXT O N N 88 ILE H H N N 89 ILE H2 H N N 90 ILE HA H N N 91 ILE HB H N N 92 ILE HG12 H N N 93 ILE HG13 H N N 94 ILE HG21 H N N 95 ILE HG22 H N N 96 ILE HG23 H N N 97 ILE HD11 H N N 98 ILE HD12 H N N 99 ILE HD13 H N N 100 ILE HXT H N N 101 LEU N N N N 102 LEU CA C N S 103 LEU C C N N 104 LEU O O N N 105 LEU CB C N N 106 LEU CG C N N 107 LEU CD1 C N N 108 LEU CD2 C N N 109 LEU OXT O N N 110 LEU H H N N 111 LEU H2 H N N 112 LEU HA H N N 113 LEU HB2 H N N 114 LEU HB3 H N N 115 LEU HG H N N 116 LEU HD11 H N N 117 LEU HD12 H N N 118 LEU HD13 H N N 119 LEU HD21 H N N 120 LEU HD22 H N N 121 LEU HD23 H N N 122 LEU HXT H N N 123 LYS N N N N 124 LYS CA C N S 125 LYS C C N N 126 LYS O O N N 127 LYS CB C N N 128 LYS CG C N N 129 LYS CD C N N 130 LYS CE C N N 131 LYS NZ N N N 132 LYS OXT O N N 133 LYS H H N N 134 LYS H2 H N N 135 LYS HA H N N 136 LYS HB2 H N N 137 LYS HB3 H N N 138 LYS HG2 H N N 139 LYS HG3 H N N 140 LYS HD2 H N N 141 LYS HD3 H N N 142 LYS HE2 H N N 143 LYS HE3 H N N 144 LYS HZ1 H N N 145 LYS HZ2 H N N 146 LYS HZ3 H N N 147 LYS HXT H N N 148 PHE N N N N 149 PHE CA C N S 150 PHE C C N N 151 PHE O O N N 152 PHE CB C N N 153 PHE CG C Y N 154 PHE CD1 C Y N 155 PHE CD2 C Y N 156 PHE CE1 C Y N 157 PHE CE2 C Y N 158 PHE CZ C Y N 159 PHE OXT O N N 160 PHE H H N N 161 PHE H2 H N N 162 PHE HA H N N 163 PHE HB2 H N N 164 PHE HB3 H N N 165 PHE HD1 H N N 166 PHE HD2 H N N 167 PHE HE1 H N N 168 PHE HE2 H N N 169 PHE HZ H N N 170 PHE HXT H N N 171 SER N N N N 172 SER CA C N S 173 SER C C N N 174 SER O O N N 175 SER CB C N N 176 SER OG O N N 177 SER OXT O N N 178 SER H H N N 179 SER H2 H N N 180 SER HA H N N 181 SER HB2 H N N 182 SER HB3 H N N 183 SER HG H N N 184 SER HXT H N N 185 THR N N N N 186 THR CA C N S 187 THR C C N N 188 THR O O N N 189 THR CB C N R 190 THR OG1 O N N 191 THR CG2 C N N 192 THR OXT O N N 193 THR H H N N 194 THR H2 H N N 195 THR HA H N N 196 THR HB H N N 197 THR HG1 H N N 198 THR HG21 H N N 199 THR HG22 H N N 200 THR HG23 H N N 201 THR HXT H N N 202 TYR N N N N 203 TYR CA C N S 204 TYR C C N N 205 TYR O O N N 206 TYR CB C N N 207 TYR CG C Y N 208 TYR CD1 C Y N 209 TYR CD2 C Y N 210 TYR CE1 C Y N 211 TYR CE2 C Y N 212 TYR CZ C Y N 213 TYR OH O N N 214 TYR OXT O N N 215 TYR H H N N 216 TYR H2 H N N 217 TYR HA H N N 218 TYR HB2 H N N 219 TYR HB3 H N N 220 TYR HD1 H N N 221 TYR HD2 H N N 222 TYR HE1 H N N 223 TYR HE2 H N N 224 TYR HH H N N 225 TYR HXT H N N 226 VAL N N N N 227 VAL CA C N S 228 VAL C C N N 229 VAL O O N N 230 VAL CB C N N 231 VAL CG1 C N N 232 VAL CG2 C N N 233 VAL OXT O N N 234 VAL H H N N 235 VAL H2 H N N 236 VAL HA H N N 237 VAL HB H N N 238 VAL HG11 H N N 239 VAL HG12 H N N 240 VAL HG13 H N N 241 VAL HG21 H N N 242 VAL HG22 H N N 243 VAL HG23 H N N 244 VAL HXT H N N 245 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 GLN N CA sing N N 29 GLN N H sing N N 30 GLN N H2 sing N N 31 GLN CA C sing N N 32 GLN CA CB sing N N 33 GLN CA HA sing N N 34 GLN C O doub N N 35 GLN C OXT sing N N 36 GLN CB CG sing N N 37 GLN CB HB2 sing N N 38 GLN CB HB3 sing N N 39 GLN CG CD sing N N 40 GLN CG HG2 sing N N 41 GLN CG HG3 sing N N 42 GLN CD OE1 doub N N 43 GLN CD NE2 sing N N 44 GLN NE2 HE21 sing N N 45 GLN NE2 HE22 sing N N 46 GLN OXT HXT sing N N 47 GLU N CA sing N N 48 GLU N H sing N N 49 GLU N H2 sing N N 50 GLU CA C sing N N 51 GLU CA CB sing N N 52 GLU CA HA sing N N 53 GLU C O doub N N 54 GLU C OXT sing N N 55 GLU CB CG sing N N 56 GLU CB HB2 sing N N 57 GLU CB HB3 sing N N 58 GLU CG CD sing N N 59 GLU CG HG2 sing N N 60 GLU CG HG3 sing N N 61 GLU CD OE1 doub N N 62 GLU CD OE2 sing N N 63 GLU OE2 HE2 sing N N 64 GLU OXT HXT sing N N 65 GLY N CA sing N N 66 GLY N H sing N N 67 GLY N H2 sing N N 68 GLY CA C sing N N 69 GLY CA HA2 sing N N 70 GLY CA HA3 sing N N 71 GLY C O doub N N 72 GLY C OXT sing N N 73 GLY OXT HXT sing N N 74 ILE N CA sing N N 75 ILE N H sing N N 76 ILE N H2 sing N N 77 ILE CA C sing N N 78 ILE CA CB sing N N 79 ILE CA HA sing N N 80 ILE C O doub N N 81 ILE C OXT sing N N 82 ILE CB CG1 sing N N 83 ILE CB CG2 sing N N 84 ILE CB HB sing N N 85 ILE CG1 CD1 sing N N 86 ILE CG1 HG12 sing N N 87 ILE CG1 HG13 sing N N 88 ILE CG2 HG21 sing N N 89 ILE CG2 HG22 sing N N 90 ILE CG2 HG23 sing N N 91 ILE CD1 HD11 sing N N 92 ILE CD1 HD12 sing N N 93 ILE CD1 HD13 sing N N 94 ILE OXT HXT sing N N 95 LEU N CA sing N N 96 LEU N H sing N N 97 LEU N H2 sing N N 98 LEU CA C sing N N 99 LEU CA CB sing N N 100 LEU CA HA sing N N 101 LEU C O doub N N 102 LEU C OXT sing N N 103 LEU CB CG sing N N 104 LEU CB HB2 sing N N 105 LEU CB HB3 sing N N 106 LEU CG CD1 sing N N 107 LEU CG CD2 sing N N 108 LEU CG HG sing N N 109 LEU CD1 HD11 sing N N 110 LEU CD1 HD12 sing N N 111 LEU CD1 HD13 sing N N 112 LEU CD2 HD21 sing N N 113 LEU CD2 HD22 sing N N 114 LEU CD2 HD23 sing N N 115 LEU OXT HXT sing N N 116 LYS N CA sing N N 117 LYS N H sing N N 118 LYS N H2 sing N N 119 LYS CA C sing N N 120 LYS CA CB sing N N 121 LYS CA HA sing N N 122 LYS C O doub N N 123 LYS C OXT sing N N 124 LYS CB CG sing N N 125 LYS CB HB2 sing N N 126 LYS CB HB3 sing N N 127 LYS CG CD sing N N 128 LYS CG HG2 sing N N 129 LYS CG HG3 sing N N 130 LYS CD CE sing N N 131 LYS CD HD2 sing N N 132 LYS CD HD3 sing N N 133 LYS CE NZ sing N N 134 LYS CE HE2 sing N N 135 LYS CE HE3 sing N N 136 LYS NZ HZ1 sing N N 137 LYS NZ HZ2 sing N N 138 LYS NZ HZ3 sing N N 139 LYS OXT HXT sing N N 140 PHE N CA sing N N 141 PHE N H sing N N 142 PHE N H2 sing N N 143 PHE CA C sing N N 144 PHE CA CB sing N N 145 PHE CA HA sing N N 146 PHE C O doub N N 147 PHE C OXT sing N N 148 PHE CB CG sing N N 149 PHE CB HB2 sing N N 150 PHE CB HB3 sing N N 151 PHE CG CD1 doub Y N 152 PHE CG CD2 sing Y N 153 PHE CD1 CE1 sing Y N 154 PHE CD1 HD1 sing N N 155 PHE CD2 CE2 doub Y N 156 PHE CD2 HD2 sing N N 157 PHE CE1 CZ doub Y N 158 PHE CE1 HE1 sing N N 159 PHE CE2 CZ sing Y N 160 PHE CE2 HE2 sing N N 161 PHE CZ HZ sing N N 162 PHE OXT HXT sing N N 163 SER N CA sing N N 164 SER N H sing N N 165 SER N H2 sing N N 166 SER CA C sing N N 167 SER CA CB sing N N 168 SER CA HA sing N N 169 SER C O doub N N 170 SER C OXT sing N N 171 SER CB OG sing N N 172 SER CB HB2 sing N N 173 SER CB HB3 sing N N 174 SER OG HG sing N N 175 SER OXT HXT sing N N 176 THR N CA sing N N 177 THR N H sing N N 178 THR N H2 sing N N 179 THR CA C sing N N 180 THR CA CB sing N N 181 THR CA HA sing N N 182 THR C O doub N N 183 THR C OXT sing N N 184 THR CB OG1 sing N N 185 THR CB CG2 sing N N 186 THR CB HB sing N N 187 THR OG1 HG1 sing N N 188 THR CG2 HG21 sing N N 189 THR CG2 HG22 sing N N 190 THR CG2 HG23 sing N N 191 THR OXT HXT sing N N 192 TYR N CA sing N N 193 TYR N H sing N N 194 TYR N H2 sing N N 195 TYR CA C sing N N 196 TYR CA CB sing N N 197 TYR CA HA sing N N 198 TYR C O doub N N 199 TYR C OXT sing N N 200 TYR CB CG sing N N 201 TYR CB HB2 sing N N 202 TYR CB HB3 sing N N 203 TYR CG CD1 doub Y N 204 TYR CG CD2 sing Y N 205 TYR CD1 CE1 sing Y N 206 TYR CD1 HD1 sing N N 207 TYR CD2 CE2 doub Y N 208 TYR CD2 HD2 sing N N 209 TYR CE1 CZ doub Y N 210 TYR CE1 HE1 sing N N 211 TYR CE2 CZ sing Y N 212 TYR CE2 HE2 sing N N 213 TYR CZ OH sing N N 214 TYR OH HH sing N N 215 TYR OXT HXT sing N N 216 VAL N CA sing N N 217 VAL N H sing N N 218 VAL N H2 sing N N 219 VAL CA C sing N N 220 VAL CA CB sing N N 221 VAL CA HA sing N N 222 VAL C O doub N N 223 VAL C OXT sing N N 224 VAL CB CG1 sing N N 225 VAL CB CG2 sing N N 226 VAL CB HB sing N N 227 VAL CG1 HG11 sing N N 228 VAL CG1 HG12 sing N N 229 VAL CG1 HG13 sing N N 230 VAL CG2 HG21 sing N N 231 VAL CG2 HG22 sing N N 232 VAL CG2 HG23 sing N N 233 VAL OXT HXT sing N N 234 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _atom_sites.entry_id 2KJF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_