data_2KJS # _entry.id 2KJS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2KJS RCSB RCSB101207 WWPDB D_1000101207 # loop_ _pdbx_database_PDB_obs_spr.id _pdbx_database_PDB_obs_spr.date _pdbx_database_PDB_obs_spr.pdb_id _pdbx_database_PDB_obs_spr.replace_pdb_id _pdbx_database_PDB_obs_spr.details SPRSDE 2009-06-23 2KJS 2KCI ? OBSLTE 2011-04-06 2KWM 2KJS ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details TargetDB GmR141 unspecified . BMRB 16081 unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KJS _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-06-08 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_mr OBS _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Smola, M.J.' 1 'Ramelot, T.A.' 2 'Zhao, L.' 3 'Hamilton, K.' 4 'Foote, E.L.' 5 'Xiao, R.' 6 'Nair, R.' 7 'Everett, J.K.' 8 'Swapna, G.' 9 'Acton, T.B.' 10 'Rost, B.' 11 'Montelione, G.T.' 12 'Kennedy, M.A.' 13 'Northeast Structural Genomics Consortium (NESG)' 14 # _citation.id primary _citation.title ;Solution NMR structure of holo acyl carrier protein from Geobacter metallireducens. Northeast Structural Genomics Consortium Target GmR141 ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Smola, M.J.' 1 primary 'Ramelot, T.A.' 2 primary 'Zhao, L.' 3 primary 'Hamilton, K.' 4 primary 'Foote, E.L.' 5 primary 'Xiao, R.' 6 primary 'Nair, R.' 7 primary 'Everett, J.K.' 8 primary 'Swapna, G.' 9 primary 'Acton, T.B.' 10 primary 'Rost, B.' 11 primary 'Montelione, G.T.' 12 primary 'Kennedy, M.A.' 13 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative acyl carrier protein' 10024.452 1 ? ? ? ? 2 non-polymer syn "4'-PHOSPHOPANTETHEINE" 358.348 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPTLDALTPIFRQVFDDDSIVLTRETSANDIDAWDSLSHMNLIVSLEVHYKIKFALGELQKLKNVGDLADLVDKKLARKL EHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MPTLDALTPIFRQVFDDDSIVLTRETSANDIDAWDSLSHMNLIVSLEVHYKIKFALGELQKLKNVGDLADLVDKKLARKL EHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier GmR141 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 THR n 1 4 LEU n 1 5 ASP n 1 6 ALA n 1 7 LEU n 1 8 THR n 1 9 PRO n 1 10 ILE n 1 11 PHE n 1 12 ARG n 1 13 GLN n 1 14 VAL n 1 15 PHE n 1 16 ASP n 1 17 ASP n 1 18 ASP n 1 19 SER n 1 20 ILE n 1 21 VAL n 1 22 LEU n 1 23 THR n 1 24 ARG n 1 25 GLU n 1 26 THR n 1 27 SER n 1 28 ALA n 1 29 ASN n 1 30 ASP n 1 31 ILE n 1 32 ASP n 1 33 ALA n 1 34 TRP n 1 35 ASP n 1 36 SER n 1 37 LEU n 1 38 SER n 1 39 HIS n 1 40 MET n 1 41 ASN n 1 42 LEU n 1 43 ILE n 1 44 VAL n 1 45 SER n 1 46 LEU n 1 47 GLU n 1 48 VAL n 1 49 HIS n 1 50 TYR n 1 51 LYS n 1 52 ILE n 1 53 LYS n 1 54 PHE n 1 55 ALA n 1 56 LEU n 1 57 GLY n 1 58 GLU n 1 59 LEU n 1 60 GLN n 1 61 LYS n 1 62 LEU n 1 63 LYS n 1 64 ASN n 1 65 VAL n 1 66 GLY n 1 67 ASP n 1 68 LEU n 1 69 ALA n 1 70 ASP n 1 71 LEU n 1 72 VAL n 1 73 ASP n 1 74 LYS n 1 75 LYS n 1 76 LEU n 1 77 ALA n 1 78 ARG n 1 79 LYS n 1 80 LEU n 1 81 GLU n 1 82 HIS n 1 83 HIS n 1 84 HIS n 1 85 HIS n 1 86 HIS n 1 87 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Gmet_2339 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Geobacter metallireducens GS-15' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 269799 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 53774 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) pMGK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET21-23C _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q39T60_GEOMG _struct_ref.pdbx_db_accession Q39T60 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MPTLDALTPIFRQVFDDDSIVLTRETSANDIDAWDSLSHMNLIVSLEVHYKIKFALGELQKLKNVGDLADLVDKKLARK _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KJS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 79 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q39T60 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 79 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 79 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KJS LEU A 80 ? UNP Q39T60 ? ? 'EXPRESSION TAG' 80 1 1 2KJS GLU A 81 ? UNP Q39T60 ? ? 'EXPRESSION TAG' 81 2 1 2KJS HIS A 82 ? UNP Q39T60 ? ? 'EXPRESSION TAG' 82 3 1 2KJS HIS A 83 ? UNP Q39T60 ? ? 'EXPRESSION TAG' 83 4 1 2KJS HIS A 84 ? UNP Q39T60 ? ? 'EXPRESSION TAG' 84 5 1 2KJS HIS A 85 ? UNP Q39T60 ? ? 'EXPRESSION TAG' 85 6 1 2KJS HIS A 86 ? UNP Q39T60 ? ? 'EXPRESSION TAG' 86 7 1 2KJS HIS A 87 ? UNP Q39T60 ? ? 'EXPRESSION TAG' 87 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PNS non-polymer . "4'-PHOSPHOPANTETHEINE" ? 'C11 H23 N2 O7 P S' 358.348 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D 1H-15N NOESY' 1 4 1 '3D 1H-13C NOESY' 1 5 2 '4D 1H-13C NOESY' 1 6 1 '3D HNCO' 1 7 1 '3D CBCA(CO)NH' 1 8 1 '3D HNCACB' 1 9 1 '3D C(CO)NH' 1 10 1 '3D HBHA(CO)NH' 1 11 1 '3D HCCH-TOCSY' 1 12 1 '3D HCCH-COSY' 1 13 2 '2D 1H-15N HSQC' 1 14 2 '2D 1H-13C HSQC' 1 15 3 '2D 1H-13C HSQC' 1 16 1 '3D H(CCO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 273 # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 100 mM DTT, 0.02 % sodium azide, 0.74 mM [U-100% 13C; U-100% 15N] protein, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 100 mM DTT, 0.02 % sodium azide, 0.74 mM [U-100% 13C; U-100% 15N] protein, 100% D2O ; 2 '100% D2O' ;20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 100 mM DTT, 0.02 % sodium azide, 0.83 mM [U-5% 13C; U-100% 15N] protein, 95% H2O/5% D2O ; 3 '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 850 Bruker AvanceIII 2 'Bruker AvanceIII' # _pdbx_nmr_refine.entry_id 2KJS _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'NIH-Xplor-2.20 refinement with hydrogen bond PMF, (not radius of gyration), etc.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 25 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KJS _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KJS _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe linux9 1 Varian collection VNMR 6.1C 2 'Bruker Biospin' collection TOPSPIN 2.1 3 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.2.1 4 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' X-PLOR_NIH 2.20 5 Goddard 'data analysis' SPARKY 3.113 6 'Bhattacharya and Montelione' 'structure validation' PSVS 1.3 7 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.3.0 8 '(PDBStat) R. Tejero, G.T. Montelione' 'data analysis' PDBStat 5.0 9 'Guntert, Mumenthaler and Wuthrich' 'data analysis' Cyana 2.1 10 'Schwieters, Kuszewski, Tjandra and Clore' refinement X-PLOR_NIH 2.20 11 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KJS _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KJS _struct.title ;Solution NMR structure of holo acyl carrier protein from Geobacter metallireducens. Northeast Structural Genomics Consortium Target GmR141 ; _struct.pdbx_descriptor 'Putative acyl carrier protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KJS _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' _struct_keywords.text ;alpha, ACP, PNS, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, BIOSYNTHETIC PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 3 ? ASP A 16 ? THR A 3 ASP A 16 1 ? 14 HELX_P HELX_P2 2 ASP A 35 ? LYS A 51 ? ASP A 35 LYS A 51 1 ? 17 HELX_P HELX_P3 3 ALA A 55 ? GLN A 60 ? ALA A 55 GLN A 60 1 ? 6 HELX_P HELX_P4 4 ASN A 64 ? HIS A 82 ? ASN A 64 HIS A 82 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 36 _struct_conn.ptnr1_label_atom_id OG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id PNS _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id P24 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 36 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id PNS _struct_conn.ptnr2_auth_seq_id 999 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.610 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE PNS A 999' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 TRP A 34 ? TRP A 34 . ? 1_555 ? 2 AC1 5 SER A 36 ? SER A 36 . ? 1_555 ? 3 AC1 5 HIS A 39 ? HIS A 39 . ? 1_555 ? 4 AC1 5 LEU A 62 ? LEU A 62 . ? 1_555 ? 5 AC1 5 LYS A 63 ? LYS A 63 . ? 1_555 ? # _atom_sites.entry_id 2KJS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 HIS 87 87 87 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id PNS _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 999 _pdbx_nonpoly_scheme.auth_seq_num 999 _pdbx_nonpoly_scheme.pdb_mon_id PNS _pdbx_nonpoly_scheme.auth_mon_id PNS _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-06-23 2 'Structure model' 1 1 2011-04-06 3 'Structure model' 1 2 2011-07-13 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 3 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id MES 20 mM ? 1 'sodium chloride' 100 mM ? 1 'calcium chloride' 5 mM ? 1 DTT 100 mM ? 1 'sodium azide' 0.02 % ? 1 protein 0.74 mM '[U-100% 13C; U-100% 15N]' 1 MES 20 mM ? 2 'sodium chloride' 100 mM ? 2 'calcium chloride' 5 mM ? 2 DTT 100 mM ? 2 'sodium azide' 0.02 % ? 2 protein .74 mM '[U-100% 13C; U-100% 15N]' 2 MES 20 mM ? 3 'sodium chloride' 100 mM ? 3 'calcium chloride' 5 mM ? 3 DTT 100 mM ? 3 'sodium azide' 0.02 % ? 3 protein 0.83 mM '[U-5% 13C; U-100% 15N]' 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 O A PHE 15 ? ? H A ASP 17 ? ? 1.58 2 7 O A PHE 15 ? ? H A ASP 17 ? ? 1.57 3 15 HG A SER 27 ? ? H A ASP 30 ? ? 1.35 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 3 ? ? -99.76 -70.24 2 1 SER A 19 ? ? -163.24 86.00 3 1 TRP A 34 ? ? -151.69 73.07 4 1 LYS A 63 ? ? -147.10 -42.38 5 2 THR A 3 ? ? -101.90 -69.93 6 2 ASP A 16 ? ? 42.92 20.98 7 2 SER A 19 ? ? -158.58 81.82 8 2 VAL A 21 ? ? 56.28 116.82 9 2 SER A 27 ? ? -145.87 49.66 10 2 ALA A 28 ? ? 43.75 78.74 11 2 ASN A 29 ? ? -169.90 -31.90 12 2 ALA A 33 ? ? -78.14 35.38 13 2 LYS A 63 ? ? -132.94 -37.47 14 2 HIS A 82 ? ? -41.26 98.96 15 2 HIS A 83 ? ? -153.42 -49.15 16 2 HIS A 85 ? ? 50.97 9.16 17 3 THR A 3 ? ? -100.73 -69.38 18 3 SER A 27 ? ? 65.57 136.71 19 3 TRP A 34 ? ? -151.93 76.42 20 3 GLU A 81 ? ? -98.75 -70.54 21 4 PRO A 2 ? ? -57.05 107.64 22 4 THR A 3 ? ? -103.11 -71.99 23 4 ASP A 16 ? ? -61.88 66.51 24 4 ASP A 18 ? ? 49.56 -94.03 25 4 TRP A 34 ? ? -151.85 80.92 26 4 LYS A 63 ? ? -139.22 -37.98 27 4 HIS A 82 ? ? 46.13 -100.28 28 4 HIS A 83 ? ? -166.61 104.14 29 5 THR A 3 ? ? -100.79 -69.13 30 5 ASP A 16 ? ? 50.34 17.67 31 5 ASP A 18 ? ? -81.40 -121.68 32 5 SER A 19 ? ? 69.58 -42.11 33 5 LEU A 22 ? ? 55.93 115.02 34 5 ALA A 33 ? ? -69.69 14.41 35 5 HIS A 49 ? ? -54.19 -76.12 36 5 ASN A 64 ? ? 70.39 178.75 37 5 HIS A 82 ? ? 41.61 -167.83 38 5 HIS A 83 ? ? -169.98 -60.54 39 5 HIS A 85 ? ? 57.03 166.07 40 6 THR A 3 ? ? -101.45 -68.13 41 6 PHE A 15 ? ? -82.83 39.14 42 6 ASP A 16 ? ? 67.19 -75.07 43 6 ASP A 17 ? ? 164.83 -18.86 44 6 ASP A 18 ? ? -39.16 142.02 45 6 SER A 19 ? ? -42.94 87.30 46 6 ALA A 33 ? ? -62.03 72.01 47 6 TRP A 34 ? ? -151.13 80.70 48 6 LYS A 63 ? ? -145.44 -34.12 49 6 GLU A 81 ? ? -154.53 75.76 50 6 HIS A 84 ? ? 57.77 149.51 51 6 HIS A 85 ? ? 41.48 88.09 52 6 HIS A 86 ? ? -61.35 -100.74 53 7 THR A 3 ? ? -99.78 -70.81 54 7 PHE A 15 ? ? -107.15 41.43 55 7 ASP A 16 ? ? -65.11 62.12 56 7 ASP A 18 ? ? 50.98 -87.62 57 7 ALA A 33 ? ? -67.57 13.19 58 7 LYS A 63 ? ? -158.43 30.18 59 7 GLU A 81 ? ? -167.67 84.44 60 7 HIS A 83 ? ? 58.52 131.39 61 7 HIS A 86 ? ? 59.51 -123.53 62 8 THR A 3 ? ? -89.99 -71.00 63 8 ASP A 16 ? ? 43.88 78.58 64 8 SER A 19 ? ? 44.69 97.65 65 8 ALA A 28 ? ? 80.53 -26.81 66 8 ALA A 33 ? ? -74.71 27.54 67 8 HIS A 84 ? ? 48.61 -163.78 68 9 THR A 3 ? ? -101.22 -71.13 69 9 ASP A 16 ? ? 74.49 -68.42 70 9 ASP A 17 ? ? -177.60 136.01 71 9 ASP A 18 ? ? -173.29 -72.03 72 9 SER A 19 ? ? 166.30 -66.51 73 9 ILE A 20 ? ? 50.49 104.93 74 9 ARG A 24 ? ? 81.11 -30.58 75 10 THR A 3 ? ? -101.06 -71.22 76 10 GLN A 13 ? ? -96.35 -67.14 77 10 PHE A 15 ? ? -100.79 41.04 78 10 ASP A 16 ? ? -62.53 68.04 79 10 ASP A 17 ? ? -78.94 -89.28 80 10 GLU A 25 ? ? -59.61 -0.84 81 10 SER A 27 ? ? -140.79 29.01 82 10 ALA A 28 ? ? 62.89 166.96 83 10 ASN A 29 ? ? 55.87 4.49 84 10 ALA A 33 ? ? -68.87 63.46 85 10 TRP A 34 ? ? -151.75 72.57 86 10 LYS A 63 ? ? -92.64 -76.36 87 10 HIS A 82 ? ? -42.64 94.85 88 10 HIS A 83 ? ? 48.71 -179.09 89 10 HIS A 85 ? ? 44.63 84.52 90 11 THR A 3 ? ? -90.25 -71.11 91 11 ASP A 16 ? ? 58.36 115.52 92 11 ASP A 17 ? ? -45.29 109.98 93 11 ASP A 18 ? ? -158.82 72.00 94 11 ARG A 24 ? ? 68.08 -31.34 95 11 SER A 27 ? ? 62.41 149.59 96 11 ALA A 33 ? ? -68.33 9.31 97 11 LYS A 63 ? ? -152.66 -33.50 98 11 HIS A 86 ? ? 57.26 -79.50 99 12 THR A 3 ? ? -101.04 -67.02 100 12 ASP A 16 ? ? 46.29 83.37 101 12 ASP A 18 ? ? -167.00 39.56 102 12 SER A 19 ? ? -148.02 -25.51 103 12 ASP A 30 ? ? -141.07 -43.05 104 12 ASP A 32 ? ? 55.82 5.15 105 12 GLU A 81 ? ? -79.69 -78.68 106 12 HIS A 86 ? ? 45.80 87.83 107 13 THR A 3 ? ? -101.05 -70.86 108 13 ASP A 16 ? ? 47.98 11.79 109 13 ASP A 18 ? ? -174.30 -90.53 110 13 SER A 19 ? ? -158.49 80.17 111 13 TRP A 34 ? ? -150.72 72.59 112 13 GLU A 81 ? ? -73.55 -74.71 113 13 HIS A 83 ? ? -152.46 12.14 114 13 HIS A 86 ? ? 52.43 90.22 115 14 THR A 3 ? ? -100.66 -71.97 116 14 SER A 19 ? ? 59.03 14.74 117 14 LEU A 22 ? ? 56.36 122.98 118 14 ALA A 33 ? ? -68.61 11.31 119 14 HIS A 49 ? ? -47.72 -77.29 120 14 LYS A 63 ? ? -156.94 24.46 121 15 THR A 3 ? ? -100.42 -71.05 122 15 ASP A 16 ? ? 47.71 14.79 123 15 SER A 19 ? ? -166.10 76.25 124 15 VAL A 21 ? ? 57.17 112.61 125 15 ALA A 33 ? ? -66.42 79.30 126 15 TRP A 34 ? ? -151.42 83.43 127 15 HIS A 83 ? ? -157.61 -50.09 128 15 HIS A 84 ? ? 45.92 -173.17 129 15 HIS A 85 ? ? 48.99 20.40 130 15 HIS A 86 ? ? 54.31 10.85 131 16 THR A 3 ? ? -90.63 -72.53 132 16 ASP A 16 ? ? 57.47 114.81 133 16 SER A 19 ? ? 49.76 23.55 134 16 ALA A 28 ? ? 64.12 -6.84 135 16 ALA A 33 ? ? -72.91 23.64 136 17 THR A 3 ? ? -101.08 -72.08 137 17 ASP A 17 ? ? 40.28 95.40 138 17 LEU A 22 ? ? 57.15 136.42 139 17 TRP A 34 ? ? -151.12 72.52 140 17 LYS A 63 ? ? -157.78 16.27 141 17 GLU A 81 ? ? 79.58 66.75 142 17 HIS A 84 ? ? 52.01 9.87 143 17 HIS A 86 ? ? 49.59 83.12 144 18 THR A 3 ? ? -100.51 -71.46 145 18 ASP A 16 ? ? 65.97 -32.69 146 18 VAL A 21 ? ? 56.36 113.54 147 18 ALA A 33 ? ? -152.37 21.78 148 18 LYS A 63 ? ? -140.17 11.64 149 18 HIS A 82 ? ? 45.37 -89.12 150 18 HIS A 84 ? ? 46.42 93.28 151 19 THR A 3 ? ? -99.04 -70.86 152 19 ASP A 16 ? ? 46.73 22.71 153 19 SER A 19 ? ? -162.56 99.59 154 19 LYS A 51 ? ? 31.98 73.69 155 19 LEU A 62 ? ? -65.79 -80.51 156 19 LYS A 63 ? ? 54.17 6.35 157 19 GLU A 81 ? ? -170.14 78.94 158 19 HIS A 82 ? ? -58.14 87.10 159 19 HIS A 83 ? ? -171.38 53.74 160 19 HIS A 85 ? ? 42.62 -167.27 161 20 THR A 3 ? ? -100.82 -69.72 162 20 ASP A 16 ? ? 54.81 71.70 163 20 ASP A 17 ? ? -82.30 -82.69 164 20 ASP A 18 ? ? -161.34 -42.14 165 20 SER A 19 ? ? -165.08 73.23 166 20 ALA A 33 ? ? -62.29 1.27 167 20 LYS A 63 ? ? -146.89 13.73 168 20 HIS A 82 ? ? 59.43 -76.04 169 20 HIS A 86 ? ? 47.56 86.24 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name "4'-PHOSPHOPANTETHEINE" _pdbx_entity_nonpoly.comp_id PNS #