data_2KK6 # _entry.id 2KK6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.323 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2KK6 RCSB RCSB101221 BMRB 16353 WWPDB D_1000101221 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 16353 BMRB unspecified . HR3461D TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KK6 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-06-15 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tang, Y.' 1 'Wang, D.' 2 'Nwosu, C.' 3 'Owens, L.' 4 'Xiao, R.' 5 'Liu, J.' 6 'Baran, M.C.' 7 'Swapna, G.' 8 'Acton, T.B.' 9 'Rost, B.' 10 'Montelione, G.T.' 11 'Northeast Structural Genomics Consortium (NESG)' 12 # _citation.id primary _citation.title ;Solution structure of sh2 domain of proto-oncogene tyrosine-protein kinase fer from homo sapiens, northeast structural genomics consortium (nesg) target hr3461d ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tang, Y.' 1 ? primary 'Montelione, G.T.' 2 ? # _cell.entry_id 2KK6 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2KK6 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Proto-oncogene tyrosine-protein kinase FER' _entity.formula_weight 13645.578 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.10.2 _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH2 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'c-FER, p94-FER, Tyrosine kinase 3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHSHMKPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQYVDNMYRFEGTGF SNIPQLIDHHYTTKQVITKKSGVVLLNPIPKDKKWI ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHSHMKPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQYVDNMYRFEGTGF SNIPQLIDHHYTTKQVITKKSGVVLLNPIPKDKKWI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier HR3461D # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 HIS n 1 11 MET n 1 12 LYS n 1 13 PRO n 1 14 LEU n 1 15 ALA n 1 16 GLU n 1 17 GLN n 1 18 ASP n 1 19 TRP n 1 20 TYR n 1 21 HIS n 1 22 GLY n 1 23 ALA n 1 24 ILE n 1 25 PRO n 1 26 ARG n 1 27 ILE n 1 28 GLU n 1 29 ALA n 1 30 GLN n 1 31 GLU n 1 32 LEU n 1 33 LEU n 1 34 LYS n 1 35 LYS n 1 36 GLN n 1 37 GLY n 1 38 ASP n 1 39 PHE n 1 40 LEU n 1 41 VAL n 1 42 ARG n 1 43 GLU n 1 44 SER n 1 45 HIS n 1 46 GLY n 1 47 LYS n 1 48 PRO n 1 49 GLY n 1 50 GLU n 1 51 TYR n 1 52 VAL n 1 53 LEU n 1 54 SER n 1 55 VAL n 1 56 TYR n 1 57 SER n 1 58 ASP n 1 59 GLY n 1 60 GLN n 1 61 ARG n 1 62 ARG n 1 63 HIS n 1 64 PHE n 1 65 ILE n 1 66 ILE n 1 67 GLN n 1 68 TYR n 1 69 VAL n 1 70 ASP n 1 71 ASN n 1 72 MET n 1 73 TYR n 1 74 ARG n 1 75 PHE n 1 76 GLU n 1 77 GLY n 1 78 THR n 1 79 GLY n 1 80 PHE n 1 81 SER n 1 82 ASN n 1 83 ILE n 1 84 PRO n 1 85 GLN n 1 86 LEU n 1 87 ILE n 1 88 ASP n 1 89 HIS n 1 90 HIS n 1 91 TYR n 1 92 THR n 1 93 THR n 1 94 LYS n 1 95 GLN n 1 96 VAL n 1 97 ILE n 1 98 THR n 1 99 LYS n 1 100 LYS n 1 101 SER n 1 102 GLY n 1 103 VAL n 1 104 VAL n 1 105 LEU n 1 106 LEU n 1 107 ASN n 1 108 PRO n 1 109 ILE n 1 110 PRO n 1 111 LYS n 1 112 ASP n 1 113 LYS n 1 114 LYS n 1 115 TRP n 1 116 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FER, TYK3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET 14-15C' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FER_HUMAN _struct_ref.pdbx_db_accession P16591 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDHHY TTKQVITKKSGVVLLNPIPKDKKWI ; _struct_ref.pdbx_align_begin 453 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KK6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 12 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 116 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16591 _struct_ref_seq.db_align_beg 453 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 557 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 12 _struct_ref_seq.pdbx_auth_seq_align_end 116 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KK6 MET A 1 ? UNP P16591 ? ? 'expression tag' 1 1 1 2KK6 GLY A 2 ? UNP P16591 ? ? 'expression tag' 2 2 1 2KK6 HIS A 3 ? UNP P16591 ? ? 'expression tag' 3 3 1 2KK6 HIS A 4 ? UNP P16591 ? ? 'expression tag' 4 4 1 2KK6 HIS A 5 ? UNP P16591 ? ? 'expression tag' 5 5 1 2KK6 HIS A 6 ? UNP P16591 ? ? 'expression tag' 6 6 1 2KK6 HIS A 7 ? UNP P16591 ? ? 'expression tag' 7 7 1 2KK6 HIS A 8 ? UNP P16591 ? ? 'expression tag' 8 8 1 2KK6 SER A 9 ? UNP P16591 ? ? 'expression tag' 9 9 1 2KK6 HIS A 10 ? UNP P16591 ? ? 'expression tag' 10 10 1 2KK6 MET A 11 ? UNP P16591 ? ? 'expression tag' 11 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 2 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D HNCO' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D C(CO)NH' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY' 1 10 1 '3D HCCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.2 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.03 mM [U-100% 13C; U-100% 15N] protein, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '1.20 mM [U-10% 13C; U-100% 15N] protein, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KK6 _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KK6 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KK6 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.2 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS 1.2 2 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.1 7 'Huang, Tejero, Powers and Montelione' refinement AutoStructure 2.1 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis' AutoAssign 2.1 9 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.1 10 Goddard 'data analysis' Sparky 2.1 11 Goddard 'chemical shift assignment' Sparky 2.1 12 Goddard 'peak picking' Sparky 2.1 13 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2.1 14 'Bruker Biospin' collection TopSpin 2.1 15 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KK6 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KK6 _struct.title ;Solution structure of sh2 domain of proto-oncogene tyrosine-protein kinase fer from homo sapiens, northeast structural genomics consortium (nesg) target hr3461d ; _struct.pdbx_descriptor 'Proto-oncogene tyrosine-protein kinase FER (E.C.2.7.10.2)' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KK6 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;methods development, SH2, Proto-oncogene tyrosine-protein kinase FER, NESG, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Proto-oncogene, SH2 domain, Transferase, Tyrosine-protein kinase, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 25 ? LEU A 32 ? PRO A 25 LEU A 32 1 ? 8 HELX_P HELX_P2 2 ASN A 82 ? THR A 93 ? ASN A 82 THR A 93 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 20 ? GLY A 22 ? TYR A 20 GLY A 22 A 2 PHE A 39 ? GLU A 43 ? PHE A 39 GLU A 43 A 3 TYR A 51 ? SER A 57 ? TYR A 51 SER A 57 A 4 GLN A 60 ? VAL A 69 ? GLN A 60 VAL A 69 A 5 MET A 72 ? ARG A 74 ? MET A 72 ARG A 74 A 6 GLY A 79 ? PHE A 80 ? GLY A 79 PHE A 80 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 22 ? N GLY A 22 O GLU A 43 ? O GLU A 43 A 2 3 N LEU A 40 ? N LEU A 40 O SER A 54 ? O SER A 54 A 3 4 N TYR A 51 ? N TYR A 51 O ILE A 66 ? O ILE A 66 A 4 5 N GLN A 67 ? N GLN A 67 O ARG A 74 ? O ARG A 74 A 5 6 N TYR A 73 ? N TYR A 73 O PHE A 80 ? O PHE A 80 # _atom_sites.entry_id 2KK6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 TRP 115 115 115 TRP TRP A . n A 1 116 ILE 116 116 116 ILE ILE A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-08-11 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 1.03 ? mM '[U-100% 13C; U-100% 15N]' 1 protein-2 1.20 ? mM '[U-10% 13C; U-100% 15N]' 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 34 ? ? -134.07 -49.29 2 1 HIS A 45 ? ? -64.21 94.44 3 1 ILE A 97 ? ? -57.04 -70.26 4 1 ASN A 107 ? ? 30.42 88.55 5 2 HIS A 3 ? ? 59.01 18.67 6 2 HIS A 5 ? ? -67.53 99.29 7 2 ALA A 23 ? ? 60.52 77.11 8 2 ASN A 71 ? ? 59.47 18.34 9 2 PHE A 75 ? ? -108.96 -63.74 10 2 GLU A 76 ? ? -109.25 -71.61 11 2 ASN A 107 ? ? 31.20 85.70 12 3 GLN A 36 ? ? -59.05 102.02 13 3 GLU A 76 ? ? -114.88 -80.25 14 3 SER A 101 ? ? -94.11 -60.13 15 3 ASN A 107 ? ? 29.80 91.13 16 4 HIS A 3 ? ? -68.46 86.86 17 4 HIS A 7 ? ? -65.17 77.86 18 4 GLU A 76 ? ? -144.43 -44.36 19 4 ASN A 107 ? ? 38.95 84.00 20 4 LYS A 113 ? ? -145.48 20.10 21 5 HIS A 7 ? ? -168.68 104.43 22 5 SER A 9 ? ? -56.19 -70.15 23 5 GLN A 36 ? ? -57.63 108.81 24 5 PHE A 75 ? ? -117.73 -87.90 25 5 ASN A 107 ? ? 28.31 83.31 26 6 HIS A 5 ? ? -92.52 -81.70 27 6 GLU A 76 ? ? -72.80 -71.21 28 6 ASN A 107 ? ? 39.39 84.14 29 7 PRO A 48 ? ? -58.64 104.88 30 7 PHE A 75 ? ? -95.44 -69.57 31 7 ASN A 107 ? ? 42.69 89.18 32 7 LYS A 114 ? ? -67.69 89.75 33 8 HIS A 3 ? ? 62.59 93.74 34 8 HIS A 10 ? ? -122.24 -168.57 35 8 GLU A 76 ? ? -129.65 -88.89 36 8 SER A 101 ? ? -121.61 -59.11 37 8 ASN A 107 ? ? 41.01 86.92 38 8 ASP A 112 ? ? -58.40 107.68 39 9 GLU A 76 ? ? -157.84 -76.00 40 9 ILE A 97 ? ? -95.14 -66.25 41 9 ASN A 107 ? ? 40.57 88.56 42 9 ASP A 112 ? ? -75.32 -162.78 43 10 HIS A 3 ? ? -81.94 40.67 44 10 ASN A 107 ? ? 37.20 79.00 45 11 SER A 9 ? ? -65.70 84.09 46 11 HIS A 10 ? ? -179.07 142.68 47 11 ALA A 23 ? ? -101.97 43.04 48 11 HIS A 45 ? ? -45.93 98.60 49 11 PHE A 75 ? ? -101.34 -76.40 50 11 ASN A 107 ? ? 53.12 74.06 51 12 HIS A 3 ? ? 46.35 24.21 52 12 HIS A 10 ? ? -176.26 105.35 53 12 ALA A 23 ? ? -107.90 70.73 54 12 LYS A 34 ? ? -145.19 -10.87 55 12 GLU A 76 ? ? -144.52 -78.53 56 12 ASN A 107 ? ? 32.97 89.23 57 13 HIS A 10 ? ? -176.36 122.23 58 13 HIS A 21 ? ? -106.53 68.08 59 13 LEU A 33 ? ? -64.02 98.06 60 13 ASN A 107 ? ? 30.03 85.53 61 14 HIS A 3 ? ? -79.03 44.68 62 14 SER A 9 ? ? -175.65 149.74 63 14 HIS A 10 ? ? -144.07 36.50 64 14 GLN A 36 ? ? -50.06 108.71 65 14 PHE A 75 ? ? -103.47 -63.64 66 14 GLU A 76 ? ? -95.90 -79.25 67 14 THR A 78 ? ? -63.55 92.09 68 14 ILE A 97 ? ? -77.74 -70.97 69 14 ASN A 107 ? ? 30.61 78.79 70 14 TRP A 115 ? ? -80.07 43.20 71 15 HIS A 6 ? ? -67.96 85.29 72 15 HIS A 8 ? ? -88.01 45.51 73 15 LYS A 34 ? ? -137.82 -44.29 74 15 GLN A 36 ? ? -58.50 96.86 75 15 PHE A 75 ? ? -130.54 -78.37 76 15 ASN A 107 ? ? 41.22 83.70 77 16 HIS A 3 ? ? -137.53 -66.78 78 16 HIS A 6 ? ? -150.77 88.56 79 16 GLN A 17 ? ? -52.15 104.39 80 16 HIS A 21 ? ? -104.90 70.02 81 16 GLN A 36 ? ? -62.80 99.80 82 16 PRO A 48 ? ? -57.06 102.71 83 16 PHE A 75 ? ? -104.84 -62.52 84 16 ASN A 107 ? ? 37.81 83.05 85 17 SER A 9 ? ? 64.08 -75.47 86 17 LEU A 33 ? ? -57.92 101.78 87 17 GLU A 76 ? ? -149.95 -61.34 88 17 ASN A 107 ? ? 30.62 79.12 89 18 HIS A 21 ? ? -118.21 68.85 90 18 LYS A 34 ? ? -136.43 -39.17 91 18 GLU A 76 ? ? -145.27 -62.67 92 18 ASN A 107 ? ? 32.87 89.95 93 19 HIS A 21 ? ? -119.84 65.05 94 19 LYS A 34 ? ? -145.78 -39.81 95 19 HIS A 45 ? ? -56.56 90.67 96 19 PRO A 48 ? ? -66.24 86.55 97 19 PHE A 75 ? ? -119.94 -77.75 98 19 GLU A 76 ? ? -75.40 -71.46 99 19 ASN A 107 ? ? 55.50 79.93 100 19 LYS A 113 ? ? -77.37 40.72 101 20 HIS A 10 ? ? 57.71 79.69 102 20 LYS A 34 ? ? -133.19 -34.92 103 20 GLN A 36 ? ? -59.88 99.25 104 20 PRO A 48 ? ? -63.55 95.88 105 20 PHE A 75 ? ? -108.79 -79.56 106 20 GLU A 76 ? ? -90.06 -69.73 107 20 ASN A 107 ? ? 39.58 79.77 108 20 ASP A 112 ? ? -139.08 -70.55 #