data_2KK8 # _entry.id 2KK8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KK8 pdb_00002kk8 10.2210/pdb2kk8/pdb RCSB RCSB101223 ? ? WWPDB D_1000101223 ? ? BMRB 16355 ? 10.13018/BMR16355 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-06-30 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_database_status 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond 11 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_spectrometer.model' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 7 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KK8 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-06-16 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified AR3449A TargetDB . unspecified 16355 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mani, R.' 1 'Gurla, S.V.T.' 2 'Shastry, R.' 3 'Ciccosanti, C.' 4 'Foote, E.' 5 'Jiang, M.' 6 'Xiao, R.' 7 'Nair, R.' 8 'Everett, J.' 9 'Huang, Y.' 10 'Acton, T.' 11 'Rost, B.' 12 'Montelione, G.T.' 13 'Northeast Structural Genomics Consortium (NESG)' 14 # _citation.id primary _citation.title ;NMR Solution Structure of a Putative Uncharacterized Protein obtained from Arabidopsis thaliana: Northeast Structural Genomics Consortium Target AR3449A ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mani, R.' 1 ? primary 'Gurla, S.V.T.' 2 ? primary 'Shastry, R.' 3 ? primary 'Ciccosanti, C.' 4 ? primary 'Foote, E.' 5 ? primary 'Jiang, M.' 6 ? primary 'Xiao, R.' 7 ? primary 'Nair, R.' 8 ? primary 'Everett, J.' 9 ? primary 'Huang, Y.' 10 ? primary 'Acton, T.' 11 ? primary 'Rost, B.' 12 ? primary 'Montelione, G.T.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein AT4g05270' _entity.formula_weight 9679.011 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'sequence database residues 1-74' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHSHMKFLVENLNGSSFELEVDYRDTLLVVKQKIERSQHIPVSKQTLIVDGIVILREDLTVEQCQIVPTSDIQL EVSS ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHSHMKFLVENLNGSSFELEVDYRDTLLVVKQKIERSQHIPVSKQTLIVDGIVILREDLTVEQCQIVPTSDIQL EVSS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier AR3449A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 HIS n 1 11 MET n 1 12 LYS n 1 13 PHE n 1 14 LEU n 1 15 VAL n 1 16 GLU n 1 17 ASN n 1 18 LEU n 1 19 ASN n 1 20 GLY n 1 21 SER n 1 22 SER n 1 23 PHE n 1 24 GLU n 1 25 LEU n 1 26 GLU n 1 27 VAL n 1 28 ASP n 1 29 TYR n 1 30 ARG n 1 31 ASP n 1 32 THR n 1 33 LEU n 1 34 LEU n 1 35 VAL n 1 36 VAL n 1 37 LYS n 1 38 GLN n 1 39 LYS n 1 40 ILE n 1 41 GLU n 1 42 ARG n 1 43 SER n 1 44 GLN n 1 45 HIS n 1 46 ILE n 1 47 PRO n 1 48 VAL n 1 49 SER n 1 50 LYS n 1 51 GLN n 1 52 THR n 1 53 LEU n 1 54 ILE n 1 55 VAL n 1 56 ASP n 1 57 GLY n 1 58 ILE n 1 59 VAL n 1 60 ILE n 1 61 LEU n 1 62 ARG n 1 63 GLU n 1 64 ASP n 1 65 LEU n 1 66 THR n 1 67 VAL n 1 68 GLU n 1 69 GLN n 1 70 CYS n 1 71 GLN n 1 72 ILE n 1 73 VAL n 1 74 PRO n 1 75 THR n 1 76 SER n 1 77 ASP n 1 78 ILE n 1 79 GLN n 1 80 LEU n 1 81 GLU n 1 82 VAL n 1 83 SER n 1 84 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name thale-cress _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene At4g05270 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+ Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET21-23C _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 SER 84 84 84 SER SER A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KK8 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KK8 _struct.title ;NMR Solution Structure of a Putative Uncharacterized Protein obtained from Arabidopsis thaliana: Northeast Structural Genomics Consortium target AR3449A ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KK8 _struct_keywords.pdbx_keywords 'Structural Genomics, Unknown function' _struct_keywords.text ;Arabidopsis thaliana, AR3449A, uncharacterized putative protein, NESG, Structural Genomics, Protein Structure Initiative, Northeast Structural Genomics Consortium, Unknown function ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9M0W8_ARATH _struct_ref.pdbx_db_accession Q9M0W8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MKFLVENLNGSSFELEVDYRDTLLVVKQKIERSQHIPVSKQTLIVDGIVILREDLTVEQCQIVPTSDIQLEVSS _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KK8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 11 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 84 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9M0W8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 74 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 11 _struct_ref_seq.pdbx_auth_seq_align_end 84 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KK8 MET A 1 ? UNP Q9M0W8 ? ? 'expression tag' 1 1 1 2KK8 GLY A 2 ? UNP Q9M0W8 ? ? 'expression tag' 2 2 1 2KK8 HIS A 3 ? UNP Q9M0W8 ? ? 'expression tag' 3 3 1 2KK8 HIS A 4 ? UNP Q9M0W8 ? ? 'expression tag' 4 4 1 2KK8 HIS A 5 ? UNP Q9M0W8 ? ? 'expression tag' 5 5 1 2KK8 HIS A 6 ? UNP Q9M0W8 ? ? 'expression tag' 6 6 1 2KK8 HIS A 7 ? UNP Q9M0W8 ? ? 'expression tag' 7 7 1 2KK8 HIS A 8 ? UNP Q9M0W8 ? ? 'expression tag' 8 8 1 2KK8 SER A 9 ? UNP Q9M0W8 ? ? 'expression tag' 9 9 1 2KK8 HIS A 10 ? UNP Q9M0W8 ? ? 'expression tag' 10 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 32 ? HIS A 45 ? THR A 32 HIS A 45 1 ? 14 HELX_P HELX_P2 2 PRO A 47 ? SER A 49 ? PRO A 47 SER A 49 5 ? 3 HELX_P HELX_P3 3 THR A 66 ? GLN A 71 ? THR A 66 GLN A 71 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 22 ? VAL A 27 ? SER A 22 VAL A 27 A 2 MET A 11 ? ASN A 17 ? MET A 11 ASN A 17 A 3 ILE A 78 ? VAL A 82 ? ILE A 78 VAL A 82 A 4 GLN A 51 ? VAL A 55 ? GLN A 51 VAL A 55 A 5 ILE A 58 ? VAL A 59 ? ILE A 58 VAL A 59 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 23 ? O PHE A 23 N VAL A 15 ? N VAL A 15 A 2 3 N GLU A 16 ? N GLU A 16 O LEU A 80 ? O LEU A 80 A 3 4 O GLN A 79 ? O GLN A 79 N ILE A 54 ? N ILE A 54 A 4 5 N VAL A 55 ? N VAL A 55 O ILE A 58 ? O ILE A 58 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 HZ1 A LYS 50 ? ? O A SER 84 ? ? 1.59 2 5 HZ1 A LYS 37 ? ? OE2 A GLU 63 ? ? 1.59 3 6 OD1 A ASP 31 ? ? HZ2 A LYS 39 ? ? 1.57 4 7 HZ1 A LYS 37 ? ? OE2 A GLU 63 ? ? 1.58 5 11 HZ1 A LYS 37 ? ? OE2 A GLU 63 ? ? 1.60 6 12 HZ1 A LYS 37 ? ? OE2 A GLU 63 ? ? 1.57 7 13 HZ2 A LYS 37 ? ? OE2 A GLU 63 ? ? 1.59 8 14 HZ1 A LYS 37 ? ? OE2 A GLU 63 ? ? 1.57 9 15 HZ1 A LYS 37 ? ? OE1 A GLU 63 ? ? 1.57 10 20 HZ2 A LYS 37 ? ? OE2 A GLU 63 ? ? 1.56 11 20 H2 A MET 1 ? ? OE1 A GLU 68 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 3 ? ? 62.78 94.74 2 1 LEU A 61 ? ? -112.87 67.30 3 2 HIS A 4 ? ? -58.77 96.53 4 2 HIS A 10 ? ? 178.36 130.42 5 2 ASP A 56 ? ? 71.48 -73.58 6 2 PRO A 74 ? ? -74.50 42.29 7 3 ASP A 56 ? ? 66.49 -72.87 8 4 HIS A 3 ? ? -65.74 97.47 9 4 SER A 83 ? ? -66.97 98.36 10 5 PRO A 47 ? ? -48.05 153.93 11 5 ASP A 56 ? ? 69.73 -63.67 12 6 HIS A 10 ? ? 60.54 73.51 13 6 ASP A 56 ? ? 73.09 -16.06 14 6 ARG A 62 ? ? -126.99 -65.47 15 6 GLU A 63 ? ? 71.32 -29.08 16 6 ASP A 77 ? ? -63.38 99.77 17 7 ASP A 56 ? ? 69.71 -74.52 18 8 HIS A 3 ? ? -142.77 45.37 19 10 HIS A 8 ? ? -153.63 17.73 20 10 ASP A 56 ? ? 72.56 -56.85 21 13 HIS A 8 ? ? -58.20 100.93 22 13 HIS A 10 ? ? -167.05 99.46 23 13 ASP A 56 ? ? 69.09 -76.65 24 13 GLN A 71 ? ? 59.13 74.41 25 14 HIS A 10 ? ? -161.70 84.85 26 15 HIS A 8 ? ? -140.40 39.14 27 15 HIS A 10 ? ? 177.21 118.76 28 15 ASP A 56 ? ? 70.55 -69.66 29 16 HIS A 3 ? ? -162.52 108.59 30 16 HIS A 10 ? ? 53.54 85.33 31 17 HIS A 8 ? ? 176.60 133.33 32 17 HIS A 10 ? ? 176.39 107.42 33 17 ASP A 56 ? ? 65.77 -77.61 34 18 ASP A 56 ? ? 72.13 -70.58 35 18 GLN A 71 ? ? 64.91 80.28 36 19 ASP A 56 ? ? 74.46 -23.27 37 19 GLN A 71 ? ? 60.25 62.30 38 20 HIS A 5 ? ? -67.68 94.77 39 20 HIS A 10 ? ? -169.93 118.67 40 20 ASP A 56 ? ? 67.76 -66.83 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KK8 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.01 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.2 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KK8 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.11 mM [U-100% 13C; U-100% 15N] AR3449A, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1.22 mM [U-10% 13C; U-100% 15N] AR3449A, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id AR3449A-1 1.11 ? mM '[U-100% 13C; U-100% 15N]' 1 AR3449A-2 1.22 ? mM '[U-10% 13C; U-100% 15N]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength '5mM CaCl2, 10mM NaCl' _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C aliphatic NOESY' 1 3 1 '3D 1H-13C aromatic NOESY' 1 4 1 '2D 1H-15N HSQC' 1 5 1 '2D 1H-13C HSQC' 1 6 1 '2D 1H-15N HSQC' 1 7 1 '2D 1H-13C HSQC' 1 8 1 '3D HBHA(CO)NH' 1 9 1 '3D CBCA(CO)NH' 1 10 1 '(4,3)D GFT-HNNCABCA' 1 11 1 '(4,3)D GFT-CABCA(CO)NHN' 1 12 1 '3D HNCO' 1 13 1 '3D HNCA' 1 14 1 '3D HNCACB' 1 15 1 '3D H(CCO)NH' 1 16 1 '3D HCCH-TOCSY' 1 17 2 '3D HNHA' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KK8 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1362 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 237 _pdbx_nmr_constraints.NOE_long_range_total_count 454 _pdbx_nmr_constraints.NOE_medium_range_total_count 317 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 354 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 91 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 91 # _pdbx_nmr_refine.entry_id 2KK8 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The structure was obtained using triple resonance NMR spectroscopy. GFT-NMR experiments were used for backbone assignments. Automated NOESY assignments were made using AUTOSTRUCTURE and CYANA-2.1. Dihedral angle constraints were obteined from TALOS. The assignments were validated using AVS software. FInal structure factors determined using PSVS: ordered residues: alpha helices- 33.44, 67-70, beta strands- 22-27, 11-17, 78-82, 51-55, 58-59. Ramachandran statistics for ordered residues: 89.1% most favoured regions, 10.9% additionally favoured regions. Procheck scores for ordered residues (RAW/Z): phi/psi -0.43/-1.38, all -0.18/-1.06, MolProbity clashscores- 21.46/-2.16. RPF score for goodness fit to the NOESY data: Recall-0.998, Precision-0.93, final dp-score-0.869 ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 2.0.6 1 'Huang, Tejero, Powers and Montelione' 'structure solution' AutoStructure 2.2.1 2 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 3 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.4.0 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CYS N N N N 61 CYS CA C N R 62 CYS C C N N 63 CYS O O N N 64 CYS CB C N N 65 CYS SG S N N 66 CYS OXT O N N 67 CYS H H N N 68 CYS H2 H N N 69 CYS HA H N N 70 CYS HB2 H N N 71 CYS HB3 H N N 72 CYS HG H N N 73 CYS HXT H N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 MET N N N N 214 MET CA C N S 215 MET C C N N 216 MET O O N N 217 MET CB C N N 218 MET CG C N N 219 MET SD S N N 220 MET CE C N N 221 MET OXT O N N 222 MET H H N N 223 MET H2 H N N 224 MET HA H N N 225 MET HB2 H N N 226 MET HB3 H N N 227 MET HG2 H N N 228 MET HG3 H N N 229 MET HE1 H N N 230 MET HE2 H N N 231 MET HE3 H N N 232 MET HXT H N N 233 PHE N N N N 234 PHE CA C N S 235 PHE C C N N 236 PHE O O N N 237 PHE CB C N N 238 PHE CG C Y N 239 PHE CD1 C Y N 240 PHE CD2 C Y N 241 PHE CE1 C Y N 242 PHE CE2 C Y N 243 PHE CZ C Y N 244 PHE OXT O N N 245 PHE H H N N 246 PHE H2 H N N 247 PHE HA H N N 248 PHE HB2 H N N 249 PHE HB3 H N N 250 PHE HD1 H N N 251 PHE HD2 H N N 252 PHE HE1 H N N 253 PHE HE2 H N N 254 PHE HZ H N N 255 PHE HXT H N N 256 PRO N N N N 257 PRO CA C N S 258 PRO C C N N 259 PRO O O N N 260 PRO CB C N N 261 PRO CG C N N 262 PRO CD C N N 263 PRO OXT O N N 264 PRO H H N N 265 PRO HA H N N 266 PRO HB2 H N N 267 PRO HB3 H N N 268 PRO HG2 H N N 269 PRO HG3 H N N 270 PRO HD2 H N N 271 PRO HD3 H N N 272 PRO HXT H N N 273 SER N N N N 274 SER CA C N S 275 SER C C N N 276 SER O O N N 277 SER CB C N N 278 SER OG O N N 279 SER OXT O N N 280 SER H H N N 281 SER H2 H N N 282 SER HA H N N 283 SER HB2 H N N 284 SER HB3 H N N 285 SER HG H N N 286 SER HXT H N N 287 THR N N N N 288 THR CA C N S 289 THR C C N N 290 THR O O N N 291 THR CB C N R 292 THR OG1 O N N 293 THR CG2 C N N 294 THR OXT O N N 295 THR H H N N 296 THR H2 H N N 297 THR HA H N N 298 THR HB H N N 299 THR HG1 H N N 300 THR HG21 H N N 301 THR HG22 H N N 302 THR HG23 H N N 303 THR HXT H N N 304 TYR N N N N 305 TYR CA C N S 306 TYR C C N N 307 TYR O O N N 308 TYR CB C N N 309 TYR CG C Y N 310 TYR CD1 C Y N 311 TYR CD2 C Y N 312 TYR CE1 C Y N 313 TYR CE2 C Y N 314 TYR CZ C Y N 315 TYR OH O N N 316 TYR OXT O N N 317 TYR H H N N 318 TYR H2 H N N 319 TYR HA H N N 320 TYR HB2 H N N 321 TYR HB3 H N N 322 TYR HD1 H N N 323 TYR HD2 H N N 324 TYR HE1 H N N 325 TYR HE2 H N N 326 TYR HH H N N 327 TYR HXT H N N 328 VAL N N N N 329 VAL CA C N S 330 VAL C C N N 331 VAL O O N N 332 VAL CB C N N 333 VAL CG1 C N N 334 VAL CG2 C N N 335 VAL OXT O N N 336 VAL H H N N 337 VAL H2 H N N 338 VAL HA H N N 339 VAL HB H N N 340 VAL HG11 H N N 341 VAL HG12 H N N 342 VAL HG13 H N N 343 VAL HG21 H N N 344 VAL HG22 H N N 345 VAL HG23 H N N 346 VAL HXT H N N 347 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 CYS N CA sing N N 58 CYS N H sing N N 59 CYS N H2 sing N N 60 CYS CA C sing N N 61 CYS CA CB sing N N 62 CYS CA HA sing N N 63 CYS C O doub N N 64 CYS C OXT sing N N 65 CYS CB SG sing N N 66 CYS CB HB2 sing N N 67 CYS CB HB3 sing N N 68 CYS SG HG sing N N 69 CYS OXT HXT sing N N 70 GLN N CA sing N N 71 GLN N H sing N N 72 GLN N H2 sing N N 73 GLN CA C sing N N 74 GLN CA CB sing N N 75 GLN CA HA sing N N 76 GLN C O doub N N 77 GLN C OXT sing N N 78 GLN CB CG sing N N 79 GLN CB HB2 sing N N 80 GLN CB HB3 sing N N 81 GLN CG CD sing N N 82 GLN CG HG2 sing N N 83 GLN CG HG3 sing N N 84 GLN CD OE1 doub N N 85 GLN CD NE2 sing N N 86 GLN NE2 HE21 sing N N 87 GLN NE2 HE22 sing N N 88 GLN OXT HXT sing N N 89 GLU N CA sing N N 90 GLU N H sing N N 91 GLU N H2 sing N N 92 GLU CA C sing N N 93 GLU CA CB sing N N 94 GLU CA HA sing N N 95 GLU C O doub N N 96 GLU C OXT sing N N 97 GLU CB CG sing N N 98 GLU CB HB2 sing N N 99 GLU CB HB3 sing N N 100 GLU CG CD sing N N 101 GLU CG HG2 sing N N 102 GLU CG HG3 sing N N 103 GLU CD OE1 doub N N 104 GLU CD OE2 sing N N 105 GLU OE2 HE2 sing N N 106 GLU OXT HXT sing N N 107 GLY N CA sing N N 108 GLY N H sing N N 109 GLY N H2 sing N N 110 GLY CA C sing N N 111 GLY CA HA2 sing N N 112 GLY CA HA3 sing N N 113 GLY C O doub N N 114 GLY C OXT sing N N 115 GLY OXT HXT sing N N 116 HIS N CA sing N N 117 HIS N H sing N N 118 HIS N H2 sing N N 119 HIS CA C sing N N 120 HIS CA CB sing N N 121 HIS CA HA sing N N 122 HIS C O doub N N 123 HIS C OXT sing N N 124 HIS CB CG sing N N 125 HIS CB HB2 sing N N 126 HIS CB HB3 sing N N 127 HIS CG ND1 sing Y N 128 HIS CG CD2 doub Y N 129 HIS ND1 CE1 doub Y N 130 HIS ND1 HD1 sing N N 131 HIS CD2 NE2 sing Y N 132 HIS CD2 HD2 sing N N 133 HIS CE1 NE2 sing Y N 134 HIS CE1 HE1 sing N N 135 HIS NE2 HE2 sing N N 136 HIS OXT HXT sing N N 137 ILE N CA sing N N 138 ILE N H sing N N 139 ILE N H2 sing N N 140 ILE CA C sing N N 141 ILE CA CB sing N N 142 ILE CA HA sing N N 143 ILE C O doub N N 144 ILE C OXT sing N N 145 ILE CB CG1 sing N N 146 ILE CB CG2 sing N N 147 ILE CB HB sing N N 148 ILE CG1 CD1 sing N N 149 ILE CG1 HG12 sing N N 150 ILE CG1 HG13 sing N N 151 ILE CG2 HG21 sing N N 152 ILE CG2 HG22 sing N N 153 ILE CG2 HG23 sing N N 154 ILE CD1 HD11 sing N N 155 ILE CD1 HD12 sing N N 156 ILE CD1 HD13 sing N N 157 ILE OXT HXT sing N N 158 LEU N CA sing N N 159 LEU N H sing N N 160 LEU N H2 sing N N 161 LEU CA C sing N N 162 LEU CA CB sing N N 163 LEU CA HA sing N N 164 LEU C O doub N N 165 LEU C OXT sing N N 166 LEU CB CG sing N N 167 LEU CB HB2 sing N N 168 LEU CB HB3 sing N N 169 LEU CG CD1 sing N N 170 LEU CG CD2 sing N N 171 LEU CG HG sing N N 172 LEU CD1 HD11 sing N N 173 LEU CD1 HD12 sing N N 174 LEU CD1 HD13 sing N N 175 LEU CD2 HD21 sing N N 176 LEU CD2 HD22 sing N N 177 LEU CD2 HD23 sing N N 178 LEU OXT HXT sing N N 179 LYS N CA sing N N 180 LYS N H sing N N 181 LYS N H2 sing N N 182 LYS CA C sing N N 183 LYS CA CB sing N N 184 LYS CA HA sing N N 185 LYS C O doub N N 186 LYS C OXT sing N N 187 LYS CB CG sing N N 188 LYS CB HB2 sing N N 189 LYS CB HB3 sing N N 190 LYS CG CD sing N N 191 LYS CG HG2 sing N N 192 LYS CG HG3 sing N N 193 LYS CD CE sing N N 194 LYS CD HD2 sing N N 195 LYS CD HD3 sing N N 196 LYS CE NZ sing N N 197 LYS CE HE2 sing N N 198 LYS CE HE3 sing N N 199 LYS NZ HZ1 sing N N 200 LYS NZ HZ2 sing N N 201 LYS NZ HZ3 sing N N 202 LYS OXT HXT sing N N 203 MET N CA sing N N 204 MET N H sing N N 205 MET N H2 sing N N 206 MET CA C sing N N 207 MET CA CB sing N N 208 MET CA HA sing N N 209 MET C O doub N N 210 MET C OXT sing N N 211 MET CB CG sing N N 212 MET CB HB2 sing N N 213 MET CB HB3 sing N N 214 MET CG SD sing N N 215 MET CG HG2 sing N N 216 MET CG HG3 sing N N 217 MET SD CE sing N N 218 MET CE HE1 sing N N 219 MET CE HE2 sing N N 220 MET CE HE3 sing N N 221 MET OXT HXT sing N N 222 PHE N CA sing N N 223 PHE N H sing N N 224 PHE N H2 sing N N 225 PHE CA C sing N N 226 PHE CA CB sing N N 227 PHE CA HA sing N N 228 PHE C O doub N N 229 PHE C OXT sing N N 230 PHE CB CG sing N N 231 PHE CB HB2 sing N N 232 PHE CB HB3 sing N N 233 PHE CG CD1 doub Y N 234 PHE CG CD2 sing Y N 235 PHE CD1 CE1 sing Y N 236 PHE CD1 HD1 sing N N 237 PHE CD2 CE2 doub Y N 238 PHE CD2 HD2 sing N N 239 PHE CE1 CZ doub Y N 240 PHE CE1 HE1 sing N N 241 PHE CE2 CZ sing Y N 242 PHE CE2 HE2 sing N N 243 PHE CZ HZ sing N N 244 PHE OXT HXT sing N N 245 PRO N CA sing N N 246 PRO N CD sing N N 247 PRO N H sing N N 248 PRO CA C sing N N 249 PRO CA CB sing N N 250 PRO CA HA sing N N 251 PRO C O doub N N 252 PRO C OXT sing N N 253 PRO CB CG sing N N 254 PRO CB HB2 sing N N 255 PRO CB HB3 sing N N 256 PRO CG CD sing N N 257 PRO CG HG2 sing N N 258 PRO CG HG3 sing N N 259 PRO CD HD2 sing N N 260 PRO CD HD3 sing N N 261 PRO OXT HXT sing N N 262 SER N CA sing N N 263 SER N H sing N N 264 SER N H2 sing N N 265 SER CA C sing N N 266 SER CA CB sing N N 267 SER CA HA sing N N 268 SER C O doub N N 269 SER C OXT sing N N 270 SER CB OG sing N N 271 SER CB HB2 sing N N 272 SER CB HB3 sing N N 273 SER OG HG sing N N 274 SER OXT HXT sing N N 275 THR N CA sing N N 276 THR N H sing N N 277 THR N H2 sing N N 278 THR CA C sing N N 279 THR CA CB sing N N 280 THR CA HA sing N N 281 THR C O doub N N 282 THR C OXT sing N N 283 THR CB OG1 sing N N 284 THR CB CG2 sing N N 285 THR CB HB sing N N 286 THR OG1 HG1 sing N N 287 THR CG2 HG21 sing N N 288 THR CG2 HG22 sing N N 289 THR CG2 HG23 sing N N 290 THR OXT HXT sing N N 291 TYR N CA sing N N 292 TYR N H sing N N 293 TYR N H2 sing N N 294 TYR CA C sing N N 295 TYR CA CB sing N N 296 TYR CA HA sing N N 297 TYR C O doub N N 298 TYR C OXT sing N N 299 TYR CB CG sing N N 300 TYR CB HB2 sing N N 301 TYR CB HB3 sing N N 302 TYR CG CD1 doub Y N 303 TYR CG CD2 sing Y N 304 TYR CD1 CE1 sing Y N 305 TYR CD1 HD1 sing N N 306 TYR CD2 CE2 doub Y N 307 TYR CD2 HD2 sing N N 308 TYR CE1 CZ doub Y N 309 TYR CE1 HE1 sing N N 310 TYR CE2 CZ sing Y N 311 TYR CE2 HE2 sing N N 312 TYR CZ OH sing N N 313 TYR OH HH sing N N 314 TYR OXT HXT sing N N 315 VAL N CA sing N N 316 VAL N H sing N N 317 VAL N H2 sing N N 318 VAL CA C sing N N 319 VAL CA CB sing N N 320 VAL CA HA sing N N 321 VAL C O doub N N 322 VAL C OXT sing N N 323 VAL CB CG1 sing N N 324 VAL CB CG2 sing N N 325 VAL CB HB sing N N 326 VAL CG1 HG11 sing N N 327 VAL CG1 HG12 sing N N 328 VAL CG1 HG13 sing N N 329 VAL CG2 HG21 sing N N 330 VAL CG2 HG22 sing N N 331 VAL CG2 HG23 sing N N 332 VAL OXT HXT sing N N 333 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' 500 Varian INOVA 3 'Varian INOVA' # _atom_sites.entry_id 2KK8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_