data_2KM0
# 
_entry.id   2KM0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.391 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2KM0         pdb_00002km0 10.2210/pdb2km0/pdb 
RCSB  RCSB101287   ?            ?                   
WWPDB D_1000101287 ?            ?                   
BMRB  16408        ?            10.13018/BMR16408   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-03-16 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2020-02-26 
4 'Structure model' 1 3 2024-05-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Data collection'           
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
5 3 'Structure model' Other                       
6 4 'Structure model' 'Data collection'           
7 4 'Structure model' 'Database references'       
8 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' database_2             
2  3 'Structure model' pdbx_database_status   
3  3 'Structure model' pdbx_nmr_spectrometer  
4  3 'Structure model' pdbx_struct_assembly   
5  3 'Structure model' pdbx_struct_oper_list  
6  4 'Structure model' chem_comp_atom         
7  4 'Structure model' chem_comp_bond         
8  4 'Structure model' database_2             
9  4 'Structure model' pdbx_struct_conn_angle 
10 4 'Structure model' struct_conn            
11 4 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_pdbx_database_status.status_code_cs'       
2  3 'Structure model' '_pdbx_nmr_spectrometer.model'               
3  4 'Structure model' '_database_2.pdbx_DOI'                       
4  4 'Structure model' '_database_2.pdbx_database_accession'        
5  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'  
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'  
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 
9  4 'Structure model' '_pdbx_struct_conn_angle.value'              
10 4 'Structure model' '_struct_conn.pdbx_dist_value'               
11 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'             
12 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'            
13 4 'Structure model' '_struct_site.pdbx_auth_asym_id'             
14 4 'Structure model' '_struct_site.pdbx_auth_comp_id'             
15 4 'Structure model' '_struct_site.pdbx_auth_seq_id'              
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KM0 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-15 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 2K0Q  PDB  'apo-CopK protein, solution structure' 
unspecified 16408 BMRB .                                      
# 
_audit_author.name           'Bersch, B.' 
_audit_author.pdbx_ordinal   1 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;CopK from Cupriavidus metallidurans CH34 Binds Cu(I) in a Tetrathioether Site: Characterization by X-ray Absorption and NMR Spectroscopy
;
J.Am.Chem.Soc. ?   ?   ?   2010 JACSAT US 1520-5126 ?    ? 20192263 10.1021/ja9083896         
1       
;Molecular structure and metal-binding properties of the periplasmic CopK protein expressed in Cupriavidus metallidurans CH34 during copper challenge
;
J.Mol.Biol.    380 386 403 2008 JMOBAK UK 0022-2836 0070 ? 18533181 10.1016/j.jmb.2008.05.017 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Sarret, G.'     1  ? 
primary 'Favier, A.'     2  ? 
primary 'Hazemann, J.L.' 3  ? 
primary 'Mergeay, M.'    4  ? 
primary 'Bersch, B.'     5  ? 
1       'Bersch, B.'     6  ? 
1       'Favier, A.'     7  ? 
1       'Schanda, P.'    8  ? 
1       'van Aelst, S.'  9  ? 
1       'Vallaeys, T.'   10 ? 
1       'Coves, J.'      11 ? 
1       'Mergeay, M.'    12 ? 
1       'Wattiez, R.'    13 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Copper resistance protein K' 8294.567 1 ? ? ? ? 
2 non-polymer syn 'COPPER (I) ION'              63.546   1 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEALRKGHSEGG 
_entity_poly.pdbx_seq_one_letter_code_can   VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEALRKGHSEGG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'COPPER (I) ION' 
_pdbx_entity_nonpoly.comp_id     CU1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  VAL n 
1 2  ASP n 
1 3  MET n 
1 4  SER n 
1 5  ASN n 
1 6  VAL n 
1 7  VAL n 
1 8  LYS n 
1 9  THR n 
1 10 TYR n 
1 11 ASP n 
1 12 LEU n 
1 13 GLN n 
1 14 ASP n 
1 15 GLY n 
1 16 SER n 
1 17 LYS n 
1 18 VAL n 
1 19 HIS n 
1 20 VAL n 
1 21 PHE n 
1 22 LYS n 
1 23 ASP n 
1 24 GLY n 
1 25 LYS n 
1 26 MET n 
1 27 GLY n 
1 28 MET n 
1 29 GLU n 
1 30 ASN n 
1 31 LYS n 
1 32 PHE n 
1 33 GLY n 
1 34 LYS n 
1 35 SER n 
1 36 MET n 
1 37 ASN n 
1 38 MET n 
1 39 PRO n 
1 40 GLU n 
1 41 GLY n 
1 42 LYS n 
1 43 VAL n 
1 44 MET n 
1 45 GLU n 
1 46 THR n 
1 47 ARG n 
1 48 ASP n 
1 49 GLY n 
1 50 THR n 
1 51 LYS n 
1 52 ILE n 
1 53 ILE n 
1 54 MET n 
1 55 LYS n 
1 56 GLY n 
1 57 ASN n 
1 58 GLU n 
1 59 ILE n 
1 60 PHE n 
1 61 ARG n 
1 62 LEU n 
1 63 ASP n 
1 64 GLU n 
1 65 ALA n 
1 66 LEU n 
1 67 ARG n 
1 68 LYS n 
1 69 GLY n 
1 70 HIS n 
1 71 SER n 
1 72 GLU n 
1 73 GLY n 
1 74 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    CH34 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Ralstonia metallidurans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     266264 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pET30 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CU1 non-polymer         . 'COPPER (I) ION' ? 'Cu 1'           63.546  
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  VAL 1  1  1  VAL VAL A . n 
A 1 2  ASP 2  2  2  ASP ASP A . n 
A 1 3  MET 3  3  3  MET MET A . n 
A 1 4  SER 4  4  4  SER SER A . n 
A 1 5  ASN 5  5  5  ASN ASN A . n 
A 1 6  VAL 6  6  6  VAL VAL A . n 
A 1 7  VAL 7  7  7  VAL VAL A . n 
A 1 8  LYS 8  8  8  LYS LYS A . n 
A 1 9  THR 9  9  9  THR THR A . n 
A 1 10 TYR 10 10 10 TYR TYR A . n 
A 1 11 ASP 11 11 11 ASP ASP A . n 
A 1 12 LEU 12 12 12 LEU LEU A . n 
A 1 13 GLN 13 13 13 GLN GLN A . n 
A 1 14 ASP 14 14 14 ASP ASP A . n 
A 1 15 GLY 15 15 15 GLY GLY A . n 
A 1 16 SER 16 16 16 SER SER A . n 
A 1 17 LYS 17 17 17 LYS LYS A . n 
A 1 18 VAL 18 18 18 VAL VAL A . n 
A 1 19 HIS 19 19 19 HIS HIS A . n 
A 1 20 VAL 20 20 20 VAL VAL A . n 
A 1 21 PHE 21 21 21 PHE PHE A . n 
A 1 22 LYS 22 22 22 LYS LYS A . n 
A 1 23 ASP 23 23 23 ASP ASP A . n 
A 1 24 GLY 24 24 24 GLY GLY A . n 
A 1 25 LYS 25 25 25 LYS LYS A . n 
A 1 26 MET 26 26 26 MET MET A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 MET 28 28 28 MET MET A . n 
A 1 29 GLU 29 29 29 GLU GLU A . n 
A 1 30 ASN 30 30 30 ASN ASN A . n 
A 1 31 LYS 31 31 31 LYS LYS A . n 
A 1 32 PHE 32 32 32 PHE PHE A . n 
A 1 33 GLY 33 33 33 GLY GLY A . n 
A 1 34 LYS 34 34 34 LYS LYS A . n 
A 1 35 SER 35 35 35 SER SER A . n 
A 1 36 MET 36 36 36 MET MET A . n 
A 1 37 ASN 37 37 37 ASN ASN A . n 
A 1 38 MET 38 38 38 MET MET A . n 
A 1 39 PRO 39 39 39 PRO PRO A . n 
A 1 40 GLU 40 40 40 GLU GLU A . n 
A 1 41 GLY 41 41 41 GLY GLY A . n 
A 1 42 LYS 42 42 42 LYS LYS A . n 
A 1 43 VAL 43 43 43 VAL VAL A . n 
A 1 44 MET 44 44 44 MET MET A . n 
A 1 45 GLU 45 45 45 GLU GLU A . n 
A 1 46 THR 46 46 46 THR THR A . n 
A 1 47 ARG 47 47 47 ARG ARG A . n 
A 1 48 ASP 48 48 48 ASP ASP A . n 
A 1 49 GLY 49 49 49 GLY GLY A . n 
A 1 50 THR 50 50 50 THR THR A . n 
A 1 51 LYS 51 51 51 LYS LYS A . n 
A 1 52 ILE 52 52 52 ILE ILE A . n 
A 1 53 ILE 53 53 53 ILE ILE A . n 
A 1 54 MET 54 54 54 MET MET A . n 
A 1 55 LYS 55 55 55 LYS LYS A . n 
A 1 56 GLY 56 56 56 GLY GLY A . n 
A 1 57 ASN 57 57 57 ASN ASN A . n 
A 1 58 GLU 58 58 58 GLU GLU A . n 
A 1 59 ILE 59 59 59 ILE ILE A . n 
A 1 60 PHE 60 60 60 PHE PHE A . n 
A 1 61 ARG 61 61 61 ARG ARG A . n 
A 1 62 LEU 62 62 62 LEU LEU A . n 
A 1 63 ASP 63 63 63 ASP ASP A . n 
A 1 64 GLU 64 64 64 GLU GLU A . n 
A 1 65 ALA 65 65 65 ALA ALA A . n 
A 1 66 LEU 66 66 66 LEU LEU A . n 
A 1 67 ARG 67 67 67 ARG ARG A . n 
A 1 68 LYS 68 68 68 LYS LYS A . n 
A 1 69 GLY 69 69 69 GLY GLY A . n 
A 1 70 HIS 70 70 70 HIS HIS A . n 
A 1 71 SER 71 71 71 SER SER A . n 
A 1 72 GLU 72 72 72 GLU GLU A . n 
A 1 73 GLY 73 73 73 GLY GLY A . n 
A 1 74 GLY 74 74 74 GLY GLY A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          CU1 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     75 
_pdbx_nonpoly_scheme.auth_seq_num    75 
_pdbx_nonpoly_scheme.pdb_mon_id      CU1 
_pdbx_nonpoly_scheme.auth_mon_id     CU1 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    'CopK protein bound to a single Cu(I)' 
_exptl.entry_id                   2KM0 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KM0 
_struct.title                     'Cu(I)-bound CopK' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KM0 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            
'heavy metal resistance, periplasmic copper binding protein, Copper, Periplasm, Plasmid, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    COPK_RALME 
_struct_ref.pdbx_db_accession          Q58AD3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEALRKGHSEGG 
_struct_ref.pdbx_align_begin           21 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2KM0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 74 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q58AD3 
_struct_ref_seq.db_align_beg                  21 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  94 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       74 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       LEU 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        62 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ARG 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        67 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        LEU 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         62 
_struct_conf.end_auth_comp_id        ARG 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         67 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A MET 28 SD ? ? ? 1_555 B CU1 . CU ? ? A MET 28 A CU1 75 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc2 metalc ? ? A MET 38 SD ? ? ? 1_555 B CU1 . CU ? ? A MET 38 A CU1 75 1_555 ? ? ? ? ? ? ? 2.297 ? ? 
metalc3 metalc ? ? A MET 44 SD ? ? ? 1_555 B CU1 . CU ? ? A MET 44 A CU1 75 1_555 ? ? ? ? ? ? ? 2.290 ? ? 
metalc4 metalc ? ? A MET 54 SD ? ? ? 1_555 B CU1 . CU ? ? A MET 54 A CU1 75 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SD ? A MET 28 ? A MET 28 ? 1_555 CU ? B CU1 . ? A CU1 75 ? 1_555 SD ? A MET 38 ? A MET 38 ? 1_555 108.4 ? 
2 SD ? A MET 28 ? A MET 28 ? 1_555 CU ? B CU1 . ? A CU1 75 ? 1_555 SD ? A MET 44 ? A MET 44 ? 1_555 109.4 ? 
3 SD ? A MET 38 ? A MET 38 ? 1_555 CU ? B CU1 . ? A CU1 75 ? 1_555 SD ? A MET 44 ? A MET 44 ? 1_555 106.1 ? 
4 SD ? A MET 28 ? A MET 28 ? 1_555 CU ? B CU1 . ? A CU1 75 ? 1_555 SD ? A MET 54 ? A MET 54 ? 1_555 115.3 ? 
5 SD ? A MET 38 ? A MET 38 ? 1_555 CU ? B CU1 . ? A CU1 75 ? 1_555 SD ? A MET 54 ? A MET 54 ? 1_555 111.0 ? 
6 SD ? A MET 44 ? A MET 44 ? 1_555 CU ? B CU1 . ? A CU1 75 ? 1_555 SD ? A MET 54 ? A MET 54 ? 1_555 106.2 ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 6  ? ASP A 11 ? VAL A 6  ASP A 11 
A 2 SER A 16 ? PHE A 21 ? SER A 16 PHE A 21 
A 3 MET A 26 ? ASN A 30 ? MET A 26 ASN A 30 
B 1 VAL A 43 ? GLU A 45 ? VAL A 43 GLU A 45 
B 2 LYS A 51 ? ILE A 53 ? LYS A 51 ILE A 53 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 8  ? N LYS A 8  O VAL A 20 ? O VAL A 20 
A 2 3 N HIS A 19 ? N HIS A 19 O GLY A 27 ? O GLY A 27 
B 1 2 N MET A 44 ? N MET A 44 O ILE A 52 ? O ILE A 52 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    CU1 
_struct_site.pdbx_auth_seq_id     75 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE CU1 A 75' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 MET A 28 ? MET A 28 . ? 1_555 ? 
2 AC1 4 MET A 38 ? MET A 38 . ? 1_555 ? 
3 AC1 4 MET A 44 ? MET A 44 . ? 1_555 ? 
4 AC1 4 MET A 54 ? MET A 54 . ? 1_555 ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  HE2  A MET 3  ? ? HG11 A VAL 6  ? ? 1.31 
2  2  OE1  A GLU 64 ? ? HD1  A HIS 70 ? ? 1.58 
3  2  OE1  A GLU 45 ? ? HZ2  A LYS 51 ? ? 1.59 
4  3  HG11 A VAL 20 ? ? HG2  A MET 26 ? ? 1.15 
5  3  HE2  A HIS 19 ? ? OE1  A GLU 29 ? ? 1.58 
6  3  OE2  A GLU 40 ? ? HZ1  A LYS 55 ? ? 1.60 
7  4  HB3  A LEU 62 ? ? H    A ASP 63 ? ? 1.26 
8  5  HB2  A MET 28 ? ? HE2  A MET 54 ? ? 1.23 
9  5  HB3  A LEU 62 ? ? H    A ASP 63 ? ? 1.28 
10 5  HD1  A HIS 70 ? ? OE2  A GLU 72 ? ? 1.57 
11 5  OE2  A GLU 45 ? ? HZ2  A LYS 51 ? ? 1.59 
12 6  OD1  A ASP 63 ? ? HZ3  A LYS 68 ? ? 1.54 
13 7  OE2  A GLU 64 ? ? HZ3  A LYS 68 ? ? 1.60 
14 8  OD2  A ASP 23 ? ? HZ1  A LYS 25 ? ? 1.59 
15 9  HG11 A VAL 20 ? ? HG2  A MET 26 ? ? 1.20 
16 9  OE2  A GLU 45 ? ? HZ1  A LYS 51 ? ? 1.57 
17 10 HG13 A VAL 20 ? ? HG2  A MET 26 ? ? 1.27 
18 11 HG12 A VAL 20 ? ? HG2  A MET 26 ? ? 1.18 
19 12 HG12 A VAL 20 ? ? HG2  A MET 26 ? ? 1.28 
20 13 HB3  A ASP 11 ? ? HE   A ARG 47 ? ? 1.06 
21 13 H    A MET 26 ? ? OE2  A GLU 58 ? ? 1.57 
22 13 H2   A VAL 1  ? ? OE1  A GLU 64 ? ? 1.58 
23 15 HB   A VAL 1  ? ? HD12 A LEU 62 ? ? 1.31 
24 15 HD21 A ASN 57 ? ? HG3  A GLU 58 ? ? 1.34 
25 15 OD2  A ASP 48 ? ? HG1  A THR 50 ? ? 1.56 
26 17 HG11 A VAL 20 ? ? HG2  A MET 26 ? ? 1.17 
27 18 HG13 A VAL 20 ? ? HG2  A MET 26 ? ? 1.23 
28 18 HD22 A ASN 30 ? ? HB2  A LYS 34 ? ? 1.24 
29 20 HG12 A VAL 20 ? ? HG2  A MET 26 ? ? 1.17 
30 20 HD1  A HIS 70 ? ? OE1  A GLU 72 ? ? 1.60 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 2 CE1 A TYR 10 ? ? CZ  A TYR 10 ? ? 1.477 1.381 0.096  0.013 N 
2 2 CZ  A TYR 10 ? ? CE2 A TYR 10 ? ? 1.285 1.381 -0.096 0.013 N 
3 9 CZ  A TYR 10 ? ? CE2 A TYR 10 ? ? 1.299 1.381 -0.082 0.013 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  ARG A 61 ? ? -69.14  88.36   
2   1  LEU A 62 ? ? -178.94 -52.22  
3   1  LYS A 68 ? ? -157.75 -146.23 
4   1  HIS A 70 ? ? -159.39 -81.57  
5   1  SER A 71 ? ? -87.81  -78.89  
6   1  GLU A 72 ? ? 57.56   83.80   
7   2  SER A 35 ? ? -42.64  95.53   
8   2  ARG A 61 ? ? 59.24   -170.47 
9   2  ARG A 67 ? ? -77.95  -76.18  
10  2  LYS A 68 ? ? -144.23 22.42   
11  3  PRO A 39 ? ? -83.53  -156.94 
12  3  ILE A 59 ? ? 67.12   178.14  
13  3  ARG A 61 ? ? 55.15   16.70   
14  3  LEU A 66 ? ? -102.03 -60.74  
15  4  VAL A 43 ? ? -68.36  99.83   
16  4  ARG A 61 ? ? 70.74   -126.94 
17  4  LEU A 62 ? ? -97.88  -139.24 
18  4  LYS A 68 ? ? 58.30   -104.36 
19  5  SER A 35 ? ? -56.56  104.75  
20  5  GLU A 58 ? ? -167.25 101.12  
21  5  ARG A 61 ? ? 65.14   -149.22 
22  5  LEU A 62 ? ? -77.08  -115.25 
23  5  ASP A 63 ? ? -166.46 -71.51  
24  5  LYS A 68 ? ? 62.23   93.84   
25  6  ASN A 5  ? ? -147.33 16.61   
26  6  LYS A 31 ? ? -56.45  -9.33   
27  6  LYS A 55 ? ? -138.50 -92.86  
28  6  ARG A 61 ? ? 64.80   174.89  
29  6  LEU A 62 ? ? -116.59 -95.52  
30  7  PRO A 39 ? ? -75.81  -166.87 
31  7  ILE A 59 ? ? 55.36   169.73  
32  7  ARG A 61 ? ? 36.62   75.74   
33  7  LEU A 62 ? ? -121.53 -97.55  
34  7  ASP A 63 ? ? -151.25 -72.55  
35  8  ARG A 61 ? ? 70.91   -85.68  
36  8  LEU A 62 ? ? -148.81 -53.15  
37  8  ASP A 63 ? ? 73.68   -29.35  
38  9  SER A 35 ? ? -33.06  92.54   
39  9  ARG A 61 ? ? 55.08   -84.85  
40  9  LEU A 62 ? ? 70.91   -74.42  
41  9  ASP A 63 ? ? 179.96  -32.98  
42  9  LYS A 68 ? ? -84.28  -72.32  
43  9  HIS A 70 ? ? -155.32 -68.82  
44  9  SER A 71 ? ? -140.74 -69.32  
45  10 MET A 54 ? ? -81.70  35.46   
46  10 ARG A 61 ? ? 63.42   -167.29 
47  10 ARG A 67 ? ? -106.13 -73.06  
48  10 HIS A 70 ? ? 67.21   93.12   
49  10 SER A 71 ? ? -95.50  -74.27  
50  11 SER A 35 ? ? -58.89  99.40   
51  11 LYS A 55 ? ? -140.40 -138.24 
52  11 GLU A 58 ? ? -130.57 -67.86  
53  11 ILE A 59 ? ? 75.01   -68.55  
54  11 ARG A 61 ? ? 70.82   -88.43  
55  11 LEU A 62 ? ? -175.28 131.60  
56  12 MET A 3  ? ? 56.37   10.52   
57  12 SER A 35 ? ? -58.07  108.56  
58  12 MET A 54 ? ? -75.81  47.92   
59  12 GLU A 58 ? ? -152.84 75.43   
60  12 ARG A 61 ? ? 45.55   -106.65 
61  13 SER A 35 ? ? -57.77  108.47  
62  13 PRO A 39 ? ? -84.67  -155.84 
63  13 GLU A 58 ? ? -163.08 108.11  
64  13 ILE A 59 ? ? -83.03  -91.20  
65  13 PHE A 60 ? ? -107.39 -66.37  
66  13 ARG A 61 ? ? 49.83   29.40   
67  13 LEU A 62 ? ? -145.56 37.77   
68  13 ARG A 67 ? ? -77.50  -71.09  
69  13 LYS A 68 ? ? 68.56   -48.84  
70  13 GLU A 72 ? ? 61.62   88.08   
71  14 SER A 35 ? ? -52.75  106.44  
72  14 LYS A 55 ? ? -146.10 -149.79 
73  14 ILE A 59 ? ? 71.96   -86.23  
74  14 ARG A 61 ? ? 73.03   -86.14  
75  14 LEU A 62 ? ? -120.91 -75.53  
76  14 ASP A 63 ? ? 70.87   -46.73  
77  14 ARG A 67 ? ? 54.95   78.65   
78  15 SER A 35 ? ? -49.87  109.21  
79  15 ILE A 59 ? ? -85.68  -157.93 
80  15 ARG A 61 ? ? 64.30   -31.26  
81  15 ARG A 67 ? ? -77.48  -76.28  
82  15 LYS A 68 ? ? 66.04   116.06  
83  15 HIS A 70 ? ? 69.40   112.36  
84  15 GLU A 72 ? ? 71.63   -59.52  
85  16 GLU A 58 ? ? -107.55 57.28   
86  16 ARG A 61 ? ? 61.64   -82.22  
87  16 LEU A 62 ? ? 54.15   91.36   
88  16 HIS A 70 ? ? -172.92 17.94   
89  17 MET A 3  ? ? 56.80   14.64   
90  17 LYS A 55 ? ? -132.95 -155.40 
91  17 ARG A 61 ? ? 64.29   -108.07 
92  17 LYS A 68 ? ? 74.43   -36.28  
93  17 HIS A 70 ? ? -173.44 140.67  
94  18 ARG A 61 ? ? 71.86   -97.58  
95  18 ARG A 67 ? ? -48.72  -79.86  
96  18 LYS A 68 ? ? 63.47   -71.45  
97  18 SER A 71 ? ? 67.78   -85.75  
98  19 SER A 35 ? ? -56.78  106.53  
99  19 MET A 54 ? ? -60.07  98.01   
100 19 ARG A 61 ? ? 67.56   -143.09 
101 19 LEU A 62 ? ? -109.36 -64.74  
102 19 ASP A 63 ? ? -162.18 -35.50  
103 19 LYS A 68 ? ? 71.45   -51.21  
104 19 HIS A 70 ? ? 68.57   100.14  
105 19 SER A 71 ? ? -102.83 -169.11 
106 20 SER A 35 ? ? -36.02  95.74   
107 20 GLU A 58 ? ? -152.59 55.01   
108 20 ILE A 59 ? ? -74.76  -165.26 
109 20 ARG A 61 ? ? 64.90   -23.38  
110 20 GLU A 72 ? ? 66.61   123.50  
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            1000 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KM0 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KM0 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'1 mM [U-100% 15N] CopK-1, 0.95 mM COPPER(I) ION-2, 50 mM ammonium acetate-3, 10 mM sodium ascorbate-4, 90% H2O/10% D2O' 1 
'90% H2O/10% D2O' 

'1.6 mM [U-100% 13C; U-100% 15N] CopK-5, 1.5 mM COPPER(I) ION-6, 50 mM ammonium acetate-7, 16 mM sodium ascorbate-8, 90% H2O/10% D2O' 
2 '90% H2O/10% D2O' 
'1.5 mM CopK-9, 1.4 mM COPPER(I) ION-10, 50 mM ammonium acetate-11, 14 mM sodium ascorbate-12, 100% D2O' 3 '100% D2O'        
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
CopK-1                1    ? mM '[U-100% 15N]'             1 
'COPPER(I) ION-2'     0.95 ? mM ?                          1 
'ammonium acetate-3'  50   ? mM ?                          1 
'sodium ascorbate-4'  10   ? mM ?                          1 
CopK-5                1.6  ? mM '[U-100% 13C; U-100% 15N]' 2 
'COPPER(I) ION-6'     1.5  ? mM ?                          2 
'ammonium acetate-7'  50   ? mM ?                          2 
'sodium ascorbate-8'  16   ? mM ?                          2 
CopK-9                1.5  ? mM ?                          3 
'COPPER(I) ION-10'    1.4  ? mM ?                          3 
'ammonium acetate-11' 50   ? mM ?                          3 
'sodium ascorbate-12' 14   ? mM ?                          3 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '3D 1H-15N NOESY' 
1 3  2 '3D 1H-13C NOESY' 
1 4  3 '2D 1H-1H NOESY'  
1 5  2 '3D HNCO'         
1 6  2 '3D HNCACB'       
1 7  2 '3D HN(COCA)CB'   
1 8  2 '3D HNCA'         
1 9  2 '3D C(CO)NH'      
1 10 2 '3D HCCH-TOCSY'   
# 
_pdbx_nmr_refine.entry_id           2KM0 
_pdbx_nmr_refine.method             'simulated annealing, molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe     ?   1 
'Johnson, One Moon Scientific'                      'chemical shift assignment' NMRView     ?   2 
'Torsten Herrmann'                                  'peak picking'              AtnosCandid ?   3 
'Torsten Herrmann'                                  'structure solution'        AtnosCandid ?   4 
;Linge, O'Donoghue and Nilges
;
'structure solution'        ARIA        1.2 5 
;Linge, O'Donoghue and Nilges
;
refinement                  ARIA        1.2 6 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CU1 CU   CU N N 74  
GLN N    N  N N 75  
GLN CA   C  N S 76  
GLN C    C  N N 77  
GLN O    O  N N 78  
GLN CB   C  N N 79  
GLN CG   C  N N 80  
GLN CD   C  N N 81  
GLN OE1  O  N N 82  
GLN NE2  N  N N 83  
GLN OXT  O  N N 84  
GLN H    H  N N 85  
GLN H2   H  N N 86  
GLN HA   H  N N 87  
GLN HB2  H  N N 88  
GLN HB3  H  N N 89  
GLN HG2  H  N N 90  
GLN HG3  H  N N 91  
GLN HE21 H  N N 92  
GLN HE22 H  N N 93  
GLN HXT  H  N N 94  
GLU N    N  N N 95  
GLU CA   C  N S 96  
GLU C    C  N N 97  
GLU O    O  N N 98  
GLU CB   C  N N 99  
GLU CG   C  N N 100 
GLU CD   C  N N 101 
GLU OE1  O  N N 102 
GLU OE2  O  N N 103 
GLU OXT  O  N N 104 
GLU H    H  N N 105 
GLU H2   H  N N 106 
GLU HA   H  N N 107 
GLU HB2  H  N N 108 
GLU HB3  H  N N 109 
GLU HG2  H  N N 110 
GLU HG3  H  N N 111 
GLU HE2  H  N N 112 
GLU HXT  H  N N 113 
GLY N    N  N N 114 
GLY CA   C  N N 115 
GLY C    C  N N 116 
GLY O    O  N N 117 
GLY OXT  O  N N 118 
GLY H    H  N N 119 
GLY H2   H  N N 120 
GLY HA2  H  N N 121 
GLY HA3  H  N N 122 
GLY HXT  H  N N 123 
HIS N    N  N N 124 
HIS CA   C  N S 125 
HIS C    C  N N 126 
HIS O    O  N N 127 
HIS CB   C  N N 128 
HIS CG   C  Y N 129 
HIS ND1  N  Y N 130 
HIS CD2  C  Y N 131 
HIS CE1  C  Y N 132 
HIS NE2  N  Y N 133 
HIS OXT  O  N N 134 
HIS H    H  N N 135 
HIS H2   H  N N 136 
HIS HA   H  N N 137 
HIS HB2  H  N N 138 
HIS HB3  H  N N 139 
HIS HD1  H  N N 140 
HIS HD2  H  N N 141 
HIS HE1  H  N N 142 
HIS HE2  H  N N 143 
HIS HXT  H  N N 144 
ILE N    N  N N 145 
ILE CA   C  N S 146 
ILE C    C  N N 147 
ILE O    O  N N 148 
ILE CB   C  N S 149 
ILE CG1  C  N N 150 
ILE CG2  C  N N 151 
ILE CD1  C  N N 152 
ILE OXT  O  N N 153 
ILE H    H  N N 154 
ILE H2   H  N N 155 
ILE HA   H  N N 156 
ILE HB   H  N N 157 
ILE HG12 H  N N 158 
ILE HG13 H  N N 159 
ILE HG21 H  N N 160 
ILE HG22 H  N N 161 
ILE HG23 H  N N 162 
ILE HD11 H  N N 163 
ILE HD12 H  N N 164 
ILE HD13 H  N N 165 
ILE HXT  H  N N 166 
LEU N    N  N N 167 
LEU CA   C  N S 168 
LEU C    C  N N 169 
LEU O    O  N N 170 
LEU CB   C  N N 171 
LEU CG   C  N N 172 
LEU CD1  C  N N 173 
LEU CD2  C  N N 174 
LEU OXT  O  N N 175 
LEU H    H  N N 176 
LEU H2   H  N N 177 
LEU HA   H  N N 178 
LEU HB2  H  N N 179 
LEU HB3  H  N N 180 
LEU HG   H  N N 181 
LEU HD11 H  N N 182 
LEU HD12 H  N N 183 
LEU HD13 H  N N 184 
LEU HD21 H  N N 185 
LEU HD22 H  N N 186 
LEU HD23 H  N N 187 
LEU HXT  H  N N 188 
LYS N    N  N N 189 
LYS CA   C  N S 190 
LYS C    C  N N 191 
LYS O    O  N N 192 
LYS CB   C  N N 193 
LYS CG   C  N N 194 
LYS CD   C  N N 195 
LYS CE   C  N N 196 
LYS NZ   N  N N 197 
LYS OXT  O  N N 198 
LYS H    H  N N 199 
LYS H2   H  N N 200 
LYS HA   H  N N 201 
LYS HB2  H  N N 202 
LYS HB3  H  N N 203 
LYS HG2  H  N N 204 
LYS HG3  H  N N 205 
LYS HD2  H  N N 206 
LYS HD3  H  N N 207 
LYS HE2  H  N N 208 
LYS HE3  H  N N 209 
LYS HZ1  H  N N 210 
LYS HZ2  H  N N 211 
LYS HZ3  H  N N 212 
LYS HXT  H  N N 213 
MET N    N  N N 214 
MET CA   C  N S 215 
MET C    C  N N 216 
MET O    O  N N 217 
MET CB   C  N N 218 
MET CG   C  N N 219 
MET SD   S  N N 220 
MET CE   C  N N 221 
MET OXT  O  N N 222 
MET H    H  N N 223 
MET H2   H  N N 224 
MET HA   H  N N 225 
MET HB2  H  N N 226 
MET HB3  H  N N 227 
MET HG2  H  N N 228 
MET HG3  H  N N 229 
MET HE1  H  N N 230 
MET HE2  H  N N 231 
MET HE3  H  N N 232 
MET HXT  H  N N 233 
PHE N    N  N N 234 
PHE CA   C  N S 235 
PHE C    C  N N 236 
PHE O    O  N N 237 
PHE CB   C  N N 238 
PHE CG   C  Y N 239 
PHE CD1  C  Y N 240 
PHE CD2  C  Y N 241 
PHE CE1  C  Y N 242 
PHE CE2  C  Y N 243 
PHE CZ   C  Y N 244 
PHE OXT  O  N N 245 
PHE H    H  N N 246 
PHE H2   H  N N 247 
PHE HA   H  N N 248 
PHE HB2  H  N N 249 
PHE HB3  H  N N 250 
PHE HD1  H  N N 251 
PHE HD2  H  N N 252 
PHE HE1  H  N N 253 
PHE HE2  H  N N 254 
PHE HZ   H  N N 255 
PHE HXT  H  N N 256 
PRO N    N  N N 257 
PRO CA   C  N S 258 
PRO C    C  N N 259 
PRO O    O  N N 260 
PRO CB   C  N N 261 
PRO CG   C  N N 262 
PRO CD   C  N N 263 
PRO OXT  O  N N 264 
PRO H    H  N N 265 
PRO HA   H  N N 266 
PRO HB2  H  N N 267 
PRO HB3  H  N N 268 
PRO HG2  H  N N 269 
PRO HG3  H  N N 270 
PRO HD2  H  N N 271 
PRO HD3  H  N N 272 
PRO HXT  H  N N 273 
SER N    N  N N 274 
SER CA   C  N S 275 
SER C    C  N N 276 
SER O    O  N N 277 
SER CB   C  N N 278 
SER OG   O  N N 279 
SER OXT  O  N N 280 
SER H    H  N N 281 
SER H2   H  N N 282 
SER HA   H  N N 283 
SER HB2  H  N N 284 
SER HB3  H  N N 285 
SER HG   H  N N 286 
SER HXT  H  N N 287 
THR N    N  N N 288 
THR CA   C  N S 289 
THR C    C  N N 290 
THR O    O  N N 291 
THR CB   C  N R 292 
THR OG1  O  N N 293 
THR CG2  C  N N 294 
THR OXT  O  N N 295 
THR H    H  N N 296 
THR H2   H  N N 297 
THR HA   H  N N 298 
THR HB   H  N N 299 
THR HG1  H  N N 300 
THR HG21 H  N N 301 
THR HG22 H  N N 302 
THR HG23 H  N N 303 
THR HXT  H  N N 304 
TYR N    N  N N 305 
TYR CA   C  N S 306 
TYR C    C  N N 307 
TYR O    O  N N 308 
TYR CB   C  N N 309 
TYR CG   C  Y N 310 
TYR CD1  C  Y N 311 
TYR CD2  C  Y N 312 
TYR CE1  C  Y N 313 
TYR CE2  C  Y N 314 
TYR CZ   C  Y N 315 
TYR OH   O  N N 316 
TYR OXT  O  N N 317 
TYR H    H  N N 318 
TYR H2   H  N N 319 
TYR HA   H  N N 320 
TYR HB2  H  N N 321 
TYR HB3  H  N N 322 
TYR HD1  H  N N 323 
TYR HD2  H  N N 324 
TYR HE1  H  N N 325 
TYR HE2  H  N N 326 
TYR HH   H  N N 327 
TYR HXT  H  N N 328 
VAL N    N  N N 329 
VAL CA   C  N S 330 
VAL C    C  N N 331 
VAL O    O  N N 332 
VAL CB   C  N N 333 
VAL CG1  C  N N 334 
VAL CG2  C  N N 335 
VAL OXT  O  N N 336 
VAL H    H  N N 337 
VAL H2   H  N N 338 
VAL HA   H  N N 339 
VAL HB   H  N N 340 
VAL HG11 H  N N 341 
VAL HG12 H  N N 342 
VAL HG13 H  N N 343 
VAL HG21 H  N N 344 
VAL HG22 H  N N 345 
VAL HG23 H  N N 346 
VAL HXT  H  N N 347 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
ILE N   CA   sing N N 137 
ILE N   H    sing N N 138 
ILE N   H2   sing N N 139 
ILE CA  C    sing N N 140 
ILE CA  CB   sing N N 141 
ILE CA  HA   sing N N 142 
ILE C   O    doub N N 143 
ILE C   OXT  sing N N 144 
ILE CB  CG1  sing N N 145 
ILE CB  CG2  sing N N 146 
ILE CB  HB   sing N N 147 
ILE CG1 CD1  sing N N 148 
ILE CG1 HG12 sing N N 149 
ILE CG1 HG13 sing N N 150 
ILE CG2 HG21 sing N N 151 
ILE CG2 HG22 sing N N 152 
ILE CG2 HG23 sing N N 153 
ILE CD1 HD11 sing N N 154 
ILE CD1 HD12 sing N N 155 
ILE CD1 HD13 sing N N 156 
ILE OXT HXT  sing N N 157 
LEU N   CA   sing N N 158 
LEU N   H    sing N N 159 
LEU N   H2   sing N N 160 
LEU CA  C    sing N N 161 
LEU CA  CB   sing N N 162 
LEU CA  HA   sing N N 163 
LEU C   O    doub N N 164 
LEU C   OXT  sing N N 165 
LEU CB  CG   sing N N 166 
LEU CB  HB2  sing N N 167 
LEU CB  HB3  sing N N 168 
LEU CG  CD1  sing N N 169 
LEU CG  CD2  sing N N 170 
LEU CG  HG   sing N N 171 
LEU CD1 HD11 sing N N 172 
LEU CD1 HD12 sing N N 173 
LEU CD1 HD13 sing N N 174 
LEU CD2 HD21 sing N N 175 
LEU CD2 HD22 sing N N 176 
LEU CD2 HD23 sing N N 177 
LEU OXT HXT  sing N N 178 
LYS N   CA   sing N N 179 
LYS N   H    sing N N 180 
LYS N   H2   sing N N 181 
LYS CA  C    sing N N 182 
LYS CA  CB   sing N N 183 
LYS CA  HA   sing N N 184 
LYS C   O    doub N N 185 
LYS C   OXT  sing N N 186 
LYS CB  CG   sing N N 187 
LYS CB  HB2  sing N N 188 
LYS CB  HB3  sing N N 189 
LYS CG  CD   sing N N 190 
LYS CG  HG2  sing N N 191 
LYS CG  HG3  sing N N 192 
LYS CD  CE   sing N N 193 
LYS CD  HD2  sing N N 194 
LYS CD  HD3  sing N N 195 
LYS CE  NZ   sing N N 196 
LYS CE  HE2  sing N N 197 
LYS CE  HE3  sing N N 198 
LYS NZ  HZ1  sing N N 199 
LYS NZ  HZ2  sing N N 200 
LYS NZ  HZ3  sing N N 201 
LYS OXT HXT  sing N N 202 
MET N   CA   sing N N 203 
MET N   H    sing N N 204 
MET N   H2   sing N N 205 
MET CA  C    sing N N 206 
MET CA  CB   sing N N 207 
MET CA  HA   sing N N 208 
MET C   O    doub N N 209 
MET C   OXT  sing N N 210 
MET CB  CG   sing N N 211 
MET CB  HB2  sing N N 212 
MET CB  HB3  sing N N 213 
MET CG  SD   sing N N 214 
MET CG  HG2  sing N N 215 
MET CG  HG3  sing N N 216 
MET SD  CE   sing N N 217 
MET CE  HE1  sing N N 218 
MET CE  HE2  sing N N 219 
MET CE  HE3  sing N N 220 
MET OXT HXT  sing N N 221 
PHE N   CA   sing N N 222 
PHE N   H    sing N N 223 
PHE N   H2   sing N N 224 
PHE CA  C    sing N N 225 
PHE CA  CB   sing N N 226 
PHE CA  HA   sing N N 227 
PHE C   O    doub N N 228 
PHE C   OXT  sing N N 229 
PHE CB  CG   sing N N 230 
PHE CB  HB2  sing N N 231 
PHE CB  HB3  sing N N 232 
PHE CG  CD1  doub Y N 233 
PHE CG  CD2  sing Y N 234 
PHE CD1 CE1  sing Y N 235 
PHE CD1 HD1  sing N N 236 
PHE CD2 CE2  doub Y N 237 
PHE CD2 HD2  sing N N 238 
PHE CE1 CZ   doub Y N 239 
PHE CE1 HE1  sing N N 240 
PHE CE2 CZ   sing Y N 241 
PHE CE2 HE2  sing N N 242 
PHE CZ  HZ   sing N N 243 
PHE OXT HXT  sing N N 244 
PRO N   CA   sing N N 245 
PRO N   CD   sing N N 246 
PRO N   H    sing N N 247 
PRO CA  C    sing N N 248 
PRO CA  CB   sing N N 249 
PRO CA  HA   sing N N 250 
PRO C   O    doub N N 251 
PRO C   OXT  sing N N 252 
PRO CB  CG   sing N N 253 
PRO CB  HB2  sing N N 254 
PRO CB  HB3  sing N N 255 
PRO CG  CD   sing N N 256 
PRO CG  HG2  sing N N 257 
PRO CG  HG3  sing N N 258 
PRO CD  HD2  sing N N 259 
PRO CD  HD3  sing N N 260 
PRO OXT HXT  sing N N 261 
SER N   CA   sing N N 262 
SER N   H    sing N N 263 
SER N   H2   sing N N 264 
SER CA  C    sing N N 265 
SER CA  CB   sing N N 266 
SER CA  HA   sing N N 267 
SER C   O    doub N N 268 
SER C   OXT  sing N N 269 
SER CB  OG   sing N N 270 
SER CB  HB2  sing N N 271 
SER CB  HB3  sing N N 272 
SER OG  HG   sing N N 273 
SER OXT HXT  sing N N 274 
THR N   CA   sing N N 275 
THR N   H    sing N N 276 
THR N   H2   sing N N 277 
THR CA  C    sing N N 278 
THR CA  CB   sing N N 279 
THR CA  HA   sing N N 280 
THR C   O    doub N N 281 
THR C   OXT  sing N N 282 
THR CB  OG1  sing N N 283 
THR CB  CG2  sing N N 284 
THR CB  HB   sing N N 285 
THR OG1 HG1  sing N N 286 
THR CG2 HG21 sing N N 287 
THR CG2 HG22 sing N N 288 
THR CG2 HG23 sing N N 289 
THR OXT HXT  sing N N 290 
TYR N   CA   sing N N 291 
TYR N   H    sing N N 292 
TYR N   H2   sing N N 293 
TYR CA  C    sing N N 294 
TYR CA  CB   sing N N 295 
TYR CA  HA   sing N N 296 
TYR C   O    doub N N 297 
TYR C   OXT  sing N N 298 
TYR CB  CG   sing N N 299 
TYR CB  HB2  sing N N 300 
TYR CB  HB3  sing N N 301 
TYR CG  CD1  doub Y N 302 
TYR CG  CD2  sing Y N 303 
TYR CD1 CE1  sing Y N 304 
TYR CD1 HD1  sing N N 305 
TYR CD2 CE2  doub Y N 306 
TYR CD2 HD2  sing N N 307 
TYR CE1 CZ   doub Y N 308 
TYR CE1 HE1  sing N N 309 
TYR CE2 CZ   sing Y N 310 
TYR CE2 HE2  sing N N 311 
TYR CZ  OH   sing N N 312 
TYR OH  HH   sing N N 313 
TYR OXT HXT  sing N N 314 
VAL N   CA   sing N N 315 
VAL N   H    sing N N 316 
VAL N   H2   sing N N 317 
VAL CA  C    sing N N 318 
VAL CA  CB   sing N N 319 
VAL CA  HA   sing N N 320 
VAL C   O    doub N N 321 
VAL C   OXT  sing N N 322 
VAL CB  CG1  sing N N 323 
VAL CB  CG2  sing N N 324 
VAL CB  HB   sing N N 325 
VAL CG1 HG11 sing N N 326 
VAL CG1 HG12 sing N N 327 
VAL CG1 HG13 sing N N 328 
VAL CG2 HG21 sing N N 329 
VAL CG2 HG22 sing N N 330 
VAL CG2 HG23 sing N N 331 
VAL OXT HXT  sing N N 332 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Varian 'Direct Drive' 1 'Varian DirectDrive' 
800 Varian 'Direct Drive' 2 'Varian DirectDrive' 
# 
_atom_sites.entry_id                    2KM0 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CU 
H  
N  
O  
S  
# 
loop_