data_2KN0 # _entry.id 2KN0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KN0 pdb_00002kn0 10.2210/pdb2kn0/pdb RCSB RCSB101322 ? ? WWPDB D_1000101322 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-06-29 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2013-04-10 4 'Structure model' 1 3 2013-05-01 5 'Structure model' 1 4 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' chem_comp_atom 2 5 'Structure model' chem_comp_bond 3 5 'Structure model' database_2 4 5 'Structure model' pdbx_entry_details 5 5 'Structure model' pdbx_modification_feature 6 5 'Structure model' pdbx_nmr_software 7 5 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_nmr_software.name' 4 5 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KN0 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-08-11 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 2kmz _pdbx_database_related.db_name PDB _pdbx_database_related.details 'human Fn14 solution NMR structure' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pellegrini, M.' 1 'Willen, L.' 2 'Perroud, M.' 3 'Krushinskie, D.' 4 'Strauch, K.' 5 'Cuervo, H.' 6 'Sun, Y.' 7 'Day, E.S.' 8 'Schneider, P.' 9 'Zheng, T.S.' 10 # _citation.id primary _citation.title 'Structure of the extracellular domains of human and Xenopus Fn14: implications in the evolution of TWEAK and Fn14 interactions.' _citation.journal_abbrev 'Febs J.' _citation.journal_volume 280 _citation.page_first 1818 _citation.page_last 1829 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1742-464X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23438059 _citation.pdbx_database_id_DOI 10.1111/febs.12206 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pellegrini, M.' 1 ? primary 'Willen, L.' 2 ? primary 'Perroud, M.' 3 ? primary 'Krushinskie, D.' 4 ? primary 'Strauch, K.' 5 ? primary 'Cuervo, H.' 6 ? primary 'Day, E.S.' 7 ? primary 'Schneider, P.' 8 ? primary 'Zheng, T.S.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Fn14 _entity.formula_weight 7697.484 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 23-72' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SQGECPEGRAYSQDLGKCMECSVCKNSEKSDFCQNCPSKTEQPDFPWIWVEQKLISEEDLHHHHHH _entity_poly.pdbx_seq_one_letter_code_can SQGECPEGRAYSQDLGKCMECSVCKNSEKSDFCQNCPSKTEQPDFPWIWVEQKLISEEDLHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLN n 1 3 GLY n 1 4 GLU n 1 5 CYS n 1 6 PRO n 1 7 GLU n 1 8 GLY n 1 9 ARG n 1 10 ALA n 1 11 TYR n 1 12 SER n 1 13 GLN n 1 14 ASP n 1 15 LEU n 1 16 GLY n 1 17 LYS n 1 18 CYS n 1 19 MET n 1 20 GLU n 1 21 CYS n 1 22 SER n 1 23 VAL n 1 24 CYS n 1 25 LYS n 1 26 ASN n 1 27 SER n 1 28 GLU n 1 29 LYS n 1 30 SER n 1 31 ASP n 1 32 PHE n 1 33 CYS n 1 34 GLN n 1 35 ASN n 1 36 CYS n 1 37 PRO n 1 38 SER n 1 39 LYS n 1 40 THR n 1 41 GLU n 1 42 GLN n 1 43 PRO n 1 44 ASP n 1 45 PHE n 1 46 PRO n 1 47 TRP n 1 48 ILE n 1 49 TRP n 1 50 VAL n 1 51 GLU n 1 52 GLN n 1 53 LYS n 1 54 LEU n 1 55 ILE n 1 56 SER n 1 57 GLU n 1 58 GLU n 1 59 ASP n 1 60 LEU n 1 61 HIS n 1 62 HIS n 1 63 HIS n 1 64 HIS n 1 65 HIS n 1 66 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'clawed frog,common platanna,platanna' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Fn14, tnfrsf12a' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Xenopus laevis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8355 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Pichia Pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 5 5 SER SER A . n A 1 2 GLN 2 6 6 GLN GLN A . n A 1 3 GLY 3 7 7 GLY GLY A . n A 1 4 GLU 4 8 8 GLU GLU A . n A 1 5 CYS 5 9 9 CYS CYS A . n A 1 6 PRO 6 10 10 PRO PRO A . n A 1 7 GLU 7 11 11 GLU GLU A . n A 1 8 GLY 8 12 12 GLY GLY A . n A 1 9 ARG 9 13 13 ARG ARG A . n A 1 10 ALA 10 14 14 ALA ALA A . n A 1 11 TYR 11 15 15 TYR TYR A . n A 1 12 SER 12 16 16 SER SER A . n A 1 13 GLN 13 17 17 GLN GLN A . n A 1 14 ASP 14 18 18 ASP ASP A . n A 1 15 LEU 15 19 19 LEU LEU A . n A 1 16 GLY 16 20 20 GLY GLY A . n A 1 17 LYS 17 21 21 LYS LYS A . n A 1 18 CYS 18 22 22 CYS CYS A . n A 1 19 MET 19 23 23 MET MET A . n A 1 20 GLU 20 24 24 GLU GLU A . n A 1 21 CYS 21 25 25 CYS CYS A . n A 1 22 SER 22 26 26 SER SER A . n A 1 23 VAL 23 27 27 VAL VAL A . n A 1 24 CYS 24 28 28 CYS CYS A . n A 1 25 LYS 25 29 29 LYS LYS A . n A 1 26 ASN 26 30 30 ASN ASN A . n A 1 27 SER 27 31 31 SER SER A . n A 1 28 GLU 28 32 32 GLU GLU A . n A 1 29 LYS 29 33 33 LYS LYS A . n A 1 30 SER 30 34 34 SER SER A . n A 1 31 ASP 31 35 35 ASP ASP A . n A 1 32 PHE 32 36 36 PHE PHE A . n A 1 33 CYS 33 37 37 CYS CYS A . n A 1 34 GLN 34 38 38 GLN GLN A . n A 1 35 ASN 35 39 39 ASN ASN A . n A 1 36 CYS 36 40 40 CYS CYS A . n A 1 37 PRO 37 41 41 PRO PRO A . n A 1 38 SER 38 42 42 SER SER A . n A 1 39 LYS 39 43 43 LYS LYS A . n A 1 40 THR 40 44 44 THR THR A . n A 1 41 GLU 41 45 45 GLU GLU A . n A 1 42 GLN 42 46 46 GLN GLN A . n A 1 43 PRO 43 47 47 PRO PRO A . n A 1 44 ASP 44 48 48 ASP ASP A . n A 1 45 PHE 45 49 49 PHE PHE A . n A 1 46 PRO 46 50 50 PRO PRO A . n A 1 47 TRP 47 51 51 TRP TRP A . n A 1 48 ILE 48 52 52 ILE ILE A . n A 1 49 TRP 49 53 53 TRP TRP A . n A 1 50 VAL 50 54 54 VAL VAL A . n A 1 51 GLU 51 55 ? ? ? A . n A 1 52 GLN 52 56 ? ? ? A . n A 1 53 LYS 53 57 ? ? ? A . n A 1 54 LEU 54 58 ? ? ? A . n A 1 55 ILE 55 59 ? ? ? A . n A 1 56 SER 56 60 ? ? ? A . n A 1 57 GLU 57 61 ? ? ? A . n A 1 58 GLU 58 62 ? ? ? A . n A 1 59 ASP 59 63 ? ? ? A . n A 1 60 LEU 60 64 ? ? ? A . n A 1 61 HIS 61 65 ? ? ? A . n A 1 62 HIS 62 66 ? ? ? A . n A 1 63 HIS 63 67 ? ? ? A . n A 1 64 HIS 64 68 ? ? ? A . n A 1 65 HIS 65 69 ? ? ? A . n A 1 66 HIS 66 70 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'solution NMR structure of xenopus Fn14 CRD' _exptl.entry_id 2KN0 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KN0 _struct.title 'Solution NMR Structure of xenopus Fn14' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KN0 _struct_keywords.pdbx_keywords APOPTOSIS _struct_keywords.text 'Fn14, TWEAK, TNF Receptor, CRD, mutagenesis, APOPTOSIS' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6SIX7_XENLA _struct_ref.pdbx_db_accession Q6SIX7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SQGECPEGRAYSQDLGKCMECSVCKNSEKSDFCQNCPSKTEQPDFPWIWV _struct_ref.pdbx_align_begin 23 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KN0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6SIX7 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 72 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 54 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KN0 GLU A 51 ? UNP Q6SIX7 ? ? 'expression tag' 55 1 1 2KN0 GLN A 52 ? UNP Q6SIX7 ? ? 'expression tag' 56 2 1 2KN0 LYS A 53 ? UNP Q6SIX7 ? ? 'expression tag' 57 3 1 2KN0 LEU A 54 ? UNP Q6SIX7 ? ? 'expression tag' 58 4 1 2KN0 ILE A 55 ? UNP Q6SIX7 ? ? 'expression tag' 59 5 1 2KN0 SER A 56 ? UNP Q6SIX7 ? ? 'expression tag' 60 6 1 2KN0 GLU A 57 ? UNP Q6SIX7 ? ? 'expression tag' 61 7 1 2KN0 GLU A 58 ? UNP Q6SIX7 ? ? 'expression tag' 62 8 1 2KN0 ASP A 59 ? UNP Q6SIX7 ? ? 'expression tag' 63 9 1 2KN0 LEU A 60 ? UNP Q6SIX7 ? ? 'expression tag' 64 10 1 2KN0 HIS A 61 ? UNP Q6SIX7 ? ? 'expression tag' 65 11 1 2KN0 HIS A 62 ? UNP Q6SIX7 ? ? 'expression tag' 66 12 1 2KN0 HIS A 63 ? UNP Q6SIX7 ? ? 'expression tag' 67 13 1 2KN0 HIS A 64 ? UNP Q6SIX7 ? ? 'expression tag' 68 14 1 2KN0 HIS A 65 ? UNP Q6SIX7 ? ? 'expression tag' 69 15 1 2KN0 HIS A 66 ? UNP Q6SIX7 ? ? 'expression tag' 70 16 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 18 SG ? ? A CYS 9 A CYS 22 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 25 A CYS 40 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf3 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 28 A CYS 37 1_555 ? ? ? ? ? ? ? 2.031 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 5 ? CYS A 18 ? CYS A 9 ? 1_555 CYS A 22 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 21 ? CYS A 36 ? CYS A 25 ? 1_555 CYS A 40 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 24 ? CYS A 33 ? CYS A 28 ? 1_555 CYS A 37 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 9 ? SER A 12 ? ARG A 13 SER A 16 A 2 LYS A 17 ? GLU A 20 ? LYS A 21 GLU A 24 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ALA _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 10 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 14 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id MET _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 19 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id MET _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 23 # _pdbx_entry_details.entry_id 2KN0 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 4 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLY _pdbx_validate_close_contact.auth_seq_id_1 12 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 CYS _pdbx_validate_close_contact.auth_seq_id_2 25 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 10 ? ? -64.43 -179.57 2 1 GLU A 11 ? ? -66.35 -177.55 3 1 MET A 23 ? ? -133.43 -159.48 4 1 LYS A 29 ? ? -114.19 -79.39 5 1 ASN A 30 ? ? -108.98 -70.44 6 1 SER A 31 ? ? -54.59 104.62 7 1 LYS A 33 ? ? -159.87 38.79 8 1 CYS A 37 ? ? -59.58 0.55 9 1 CYS A 40 ? ? -44.56 100.95 10 1 LYS A 43 ? ? -59.46 -176.43 11 1 THR A 44 ? ? 67.57 82.44 12 1 ASP A 48 ? ? -161.81 63.14 13 1 PRO A 50 ? ? -49.38 172.88 14 1 TRP A 51 ? ? 61.75 153.42 15 2 PRO A 10 ? ? -59.91 -165.98 16 2 GLU A 11 ? ? -65.07 -177.98 17 2 SER A 31 ? ? 63.48 126.35 18 2 GLU A 32 ? ? -139.16 -78.92 19 2 CYS A 37 ? ? -58.25 -4.33 20 2 CYS A 40 ? ? -23.74 -58.75 21 2 LYS A 43 ? ? 67.33 132.95 22 2 GLU A 45 ? ? 61.16 66.32 23 2 ASP A 48 ? ? -159.42 37.43 24 3 CYS A 9 ? ? 59.71 93.02 25 3 PRO A 10 ? ? -66.23 -167.35 26 3 GLU A 11 ? ? -62.01 -177.29 27 3 LYS A 29 ? ? -131.66 -56.33 28 3 SER A 31 ? ? 60.73 99.51 29 3 LYS A 33 ? ? -93.32 43.63 30 3 CYS A 37 ? ? -58.50 -4.58 31 3 LYS A 43 ? ? 64.97 161.62 32 3 PRO A 47 ? ? -84.21 47.75 33 4 CYS A 9 ? ? 63.55 129.70 34 4 PRO A 10 ? ? -62.46 -166.19 35 4 CYS A 37 ? ? -62.70 1.99 36 4 PRO A 41 ? ? -54.67 -172.97 37 4 LYS A 43 ? ? -177.30 128.92 38 4 ASP A 48 ? ? -148.22 40.31 39 4 TRP A 51 ? ? 61.95 116.93 40 4 TRP A 53 ? ? 67.41 89.91 41 5 PRO A 10 ? ? -55.89 -174.26 42 5 GLU A 11 ? ? -55.83 179.10 43 5 ALA A 14 ? ? -178.53 148.42 44 5 CYS A 28 ? ? -67.32 -171.98 45 5 LYS A 29 ? ? -131.90 -61.33 46 5 ASN A 30 ? ? -176.45 -41.57 47 5 CYS A 37 ? ? -65.70 2.36 48 5 THR A 44 ? ? 53.42 71.53 49 5 GLN A 46 ? ? -56.95 108.32 50 5 ASP A 48 ? ? -158.96 43.49 51 5 PHE A 49 ? ? 60.46 85.72 52 6 PRO A 10 ? ? -63.63 -165.51 53 6 GLU A 11 ? ? -68.41 -179.95 54 6 LYS A 29 ? ? 61.34 84.93 55 6 ASN A 30 ? ? -134.18 -54.14 56 6 SER A 31 ? ? -175.85 -47.45 57 6 PRO A 41 ? ? -63.51 -82.58 58 6 SER A 42 ? ? 46.90 -171.58 59 6 GLU A 45 ? ? -97.77 46.76 60 6 PRO A 47 ? ? -55.95 85.54 61 6 PHE A 49 ? ? 62.21 94.92 62 6 TRP A 53 ? ? -157.04 86.83 63 7 PRO A 10 ? ? -67.20 -176.12 64 7 GLU A 11 ? ? -55.65 -178.05 65 7 LYS A 29 ? ? -174.66 119.86 66 7 ASN A 30 ? ? 57.44 -176.83 67 7 CYS A 37 ? ? -60.63 0.96 68 7 ASP A 48 ? ? -176.68 37.77 69 7 ILE A 52 ? ? 35.11 96.30 70 8 PRO A 10 ? ? -65.32 -163.13 71 8 MET A 23 ? ? -153.94 -157.99 72 8 LYS A 29 ? ? -143.74 -47.28 73 8 ASN A 30 ? ? -101.54 -70.20 74 8 SER A 31 ? ? -141.91 -59.99 75 8 GLU A 32 ? ? 61.15 175.29 76 8 LYS A 33 ? ? -95.14 39.33 77 8 CYS A 40 ? ? -20.73 135.69 78 8 PRO A 47 ? ? -75.86 -168.02 79 8 PHE A 49 ? ? -158.00 74.65 80 8 TRP A 51 ? ? 61.90 151.09 81 9 GLN A 6 ? ? -176.73 106.70 82 9 PRO A 10 ? ? -70.93 -156.89 83 9 GLU A 11 ? ? -62.40 -177.33 84 9 CYS A 28 ? ? -43.43 96.28 85 9 LYS A 29 ? ? -150.10 -58.40 86 9 SER A 31 ? ? -173.33 -171.01 87 9 GLU A 32 ? ? -59.17 -177.39 88 9 LYS A 33 ? ? -68.03 74.21 89 9 CYS A 37 ? ? -59.27 -1.24 90 9 SER A 42 ? ? 176.68 148.08 91 9 THR A 44 ? ? -154.94 76.48 92 9 GLU A 45 ? ? 60.98 155.32 93 9 PRO A 47 ? ? -65.03 -167.10 94 9 ILE A 52 ? ? -91.30 50.71 95 9 TRP A 53 ? ? 60.90 157.82 96 10 PRO A 10 ? ? -70.88 -166.28 97 10 GLU A 11 ? ? -64.54 -178.45 98 10 LYS A 21 ? ? -177.02 145.95 99 10 MET A 23 ? ? -132.15 -157.54 100 10 ASN A 30 ? ? 48.61 88.14 101 10 SER A 31 ? ? -165.08 -49.38 102 10 CYS A 37 ? ? -58.35 -2.81 103 10 CYS A 40 ? ? -44.79 160.34 104 10 LYS A 43 ? ? 55.94 97.48 105 10 THR A 44 ? ? -178.94 -54.73 106 10 PRO A 47 ? ? -58.07 -172.20 107 10 ASP A 48 ? ? -155.48 60.18 108 10 PHE A 49 ? ? -49.14 104.51 109 11 PRO A 10 ? ? -74.10 -163.78 110 11 MET A 23 ? ? -160.89 -160.71 111 11 ASN A 30 ? ? -159.70 -52.53 112 11 CYS A 37 ? ? -58.45 0.12 113 11 GLU A 45 ? ? 62.06 116.03 114 11 PRO A 47 ? ? -66.15 86.01 115 11 ASP A 48 ? ? -158.04 44.80 116 12 CYS A 9 ? ? 62.64 120.49 117 12 PRO A 10 ? ? -72.23 -163.52 118 12 ALA A 14 ? ? 178.68 151.09 119 12 LYS A 29 ? ? 175.72 -36.56 120 12 GLU A 32 ? ? -110.20 -162.48 121 12 SER A 42 ? ? -179.28 49.32 122 12 THR A 44 ? ? 62.59 142.51 123 12 GLU A 45 ? ? -168.57 74.25 124 12 PHE A 49 ? ? -140.40 -57.19 125 12 TRP A 51 ? ? 62.37 121.77 126 12 TRP A 53 ? ? 64.20 124.70 127 13 ALA A 14 ? ? -171.34 147.88 128 13 LYS A 29 ? ? -114.30 -80.60 129 13 ASN A 30 ? ? -179.80 38.59 130 13 SER A 31 ? ? -143.92 -82.17 131 13 GLU A 32 ? ? -178.09 -144.62 132 13 LYS A 33 ? ? 71.02 38.50 133 13 CYS A 40 ? ? -28.94 -58.39 134 13 THR A 44 ? ? -164.04 111.79 135 13 PRO A 47 ? ? -51.14 108.89 136 13 ASP A 48 ? ? -159.72 37.53 137 13 PRO A 50 ? ? -81.40 -158.92 138 14 GLN A 6 ? ? 60.28 87.70 139 14 PRO A 10 ? ? -77.50 -160.36 140 14 GLU A 11 ? ? -54.45 -178.12 141 14 MET A 23 ? ? -120.57 -159.55 142 14 ASN A 30 ? ? -94.91 38.76 143 14 SER A 31 ? ? -177.68 37.33 144 14 CYS A 37 ? ? -60.77 0.47 145 14 PRO A 41 ? ? -65.74 -162.54 146 14 LYS A 43 ? ? 59.48 -173.96 147 14 GLU A 45 ? ? -169.29 107.63 148 14 ASP A 48 ? ? -173.20 67.54 149 14 TRP A 53 ? ? 69.63 102.79 150 15 GLN A 6 ? ? 66.95 -72.86 151 15 CYS A 9 ? ? 61.05 84.42 152 15 PRO A 10 ? ? -63.00 -160.81 153 15 GLU A 11 ? ? -63.30 -169.33 154 15 ASN A 30 ? ? 53.88 73.29 155 15 SER A 31 ? ? -168.90 -52.16 156 15 CYS A 37 ? ? -57.08 -3.06 157 15 SER A 42 ? ? -113.59 -71.41 158 15 THR A 44 ? ? 45.48 -170.00 159 15 PRO A 47 ? ? -66.19 83.46 160 15 TRP A 51 ? ? 61.48 116.71 161 16 GLN A 6 ? ? -162.09 -45.01 162 16 PRO A 10 ? ? -73.34 -167.54 163 16 GLU A 11 ? ? -55.48 -178.32 164 16 MET A 23 ? ? -121.82 -161.02 165 16 SER A 31 ? ? -65.12 93.66 166 16 CYS A 37 ? ? -59.53 -0.60 167 16 LYS A 43 ? ? -173.81 89.69 168 16 TRP A 53 ? ? 72.39 99.81 169 17 PRO A 10 ? ? -70.74 -166.43 170 17 GLU A 11 ? ? -58.17 -177.44 171 17 LYS A 29 ? ? 69.00 -63.59 172 17 GLU A 32 ? ? 61.89 98.65 173 17 CYS A 37 ? ? -58.22 -1.07 174 17 THR A 44 ? ? -172.85 -40.27 175 17 GLU A 45 ? ? 66.08 116.05 176 17 PRO A 47 ? ? -49.91 152.91 177 17 ASP A 48 ? ? -176.17 70.04 178 17 PHE A 49 ? ? -163.27 -65.36 179 17 PRO A 50 ? ? -54.10 88.67 180 17 TRP A 53 ? ? 60.29 99.75 181 18 GLU A 11 ? ? 55.48 153.23 182 18 LYS A 29 ? ? -151.70 -50.91 183 18 SER A 31 ? ? -98.34 57.32 184 18 GLU A 32 ? ? -54.97 105.45 185 18 CYS A 37 ? ? -58.18 -1.14 186 18 PRO A 41 ? ? -58.83 106.60 187 18 THR A 44 ? ? -63.42 85.37 188 18 PRO A 47 ? ? -69.21 57.85 189 18 TRP A 51 ? ? 59.16 177.30 190 19 GLU A 11 ? ? 54.10 117.05 191 19 LYS A 21 ? ? -170.62 -173.96 192 19 GLU A 24 ? ? -51.85 172.40 193 19 LYS A 29 ? ? -104.02 -167.37 194 19 LYS A 33 ? ? -151.19 66.16 195 19 CYS A 37 ? ? -57.66 1.07 196 19 PRO A 41 ? ? -53.81 -173.97 197 19 SER A 42 ? ? 64.42 130.01 198 19 LYS A 43 ? ? 62.66 -170.67 199 19 THR A 44 ? ? 62.68 78.29 200 19 GLU A 45 ? ? -163.41 68.39 201 19 PRO A 47 ? ? -54.25 106.42 202 19 ASP A 48 ? ? -152.44 43.90 203 19 PRO A 50 ? ? -69.22 -168.01 204 19 TRP A 53 ? ? 61.26 163.35 205 20 PRO A 10 ? ? -54.18 -168.83 206 20 ALA A 14 ? ? -171.38 -179.02 207 20 ASN A 30 ? ? -58.63 -76.02 208 20 SER A 31 ? ? -176.62 50.85 209 20 GLU A 32 ? ? -159.28 79.28 210 20 CYS A 37 ? ? -64.32 1.89 211 20 SER A 42 ? ? -59.03 -179.80 212 20 GLU A 45 ? ? -179.38 83.76 213 20 TRP A 53 ? ? -165.63 105.43 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria '20 lowest energy structures' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KN0 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KN0 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.contents '500-700 uM [U-99% 15N] xeFn14-1, 10 mM sodium phosphate-2, 137 mM sodium chloride-3, 2.7 mM potassium chloride-4, 95% H2O, 5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id xeFn14-1 ? 500-700 uM '[U-99% 15N]' 1 'sodium phosphate-2' 10 ? mM ? 1 'sodium chloride-3' 137 ? mM ? 1 'potassium chloride-4' 2.7 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 140 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.type '3D 1H-15N NOESY' # _pdbx_nmr_refine.entry_id 2KN0 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger A. T. et.al.' 'structure solution' CNS 1.1 1 Goddard 'data analysis' Sparky 3.11 2 'Brunger A. T. et.al.' refinement CNS 1.1 3 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 55 ? A GLU 51 2 1 Y 1 A GLN 56 ? A GLN 52 3 1 Y 1 A LYS 57 ? A LYS 53 4 1 Y 1 A LEU 58 ? A LEU 54 5 1 Y 1 A ILE 59 ? A ILE 55 6 1 Y 1 A SER 60 ? A SER 56 7 1 Y 1 A GLU 61 ? A GLU 57 8 1 Y 1 A GLU 62 ? A GLU 58 9 1 Y 1 A ASP 63 ? A ASP 59 10 1 Y 1 A LEU 64 ? A LEU 60 11 1 Y 1 A HIS 65 ? A HIS 61 12 1 Y 1 A HIS 66 ? A HIS 62 13 1 Y 1 A HIS 67 ? A HIS 63 14 1 Y 1 A HIS 68 ? A HIS 64 15 1 Y 1 A HIS 69 ? A HIS 65 16 1 Y 1 A HIS 70 ? A HIS 66 17 2 Y 1 A GLU 55 ? A GLU 51 18 2 Y 1 A GLN 56 ? A GLN 52 19 2 Y 1 A LYS 57 ? A LYS 53 20 2 Y 1 A LEU 58 ? A LEU 54 21 2 Y 1 A ILE 59 ? A ILE 55 22 2 Y 1 A SER 60 ? A SER 56 23 2 Y 1 A GLU 61 ? A GLU 57 24 2 Y 1 A GLU 62 ? A GLU 58 25 2 Y 1 A ASP 63 ? A ASP 59 26 2 Y 1 A LEU 64 ? A LEU 60 27 2 Y 1 A HIS 65 ? A HIS 61 28 2 Y 1 A HIS 66 ? A HIS 62 29 2 Y 1 A HIS 67 ? A HIS 63 30 2 Y 1 A HIS 68 ? A HIS 64 31 2 Y 1 A HIS 69 ? A HIS 65 32 2 Y 1 A HIS 70 ? A HIS 66 33 3 Y 1 A GLU 55 ? A GLU 51 34 3 Y 1 A GLN 56 ? A GLN 52 35 3 Y 1 A LYS 57 ? A LYS 53 36 3 Y 1 A LEU 58 ? A LEU 54 37 3 Y 1 A ILE 59 ? A ILE 55 38 3 Y 1 A SER 60 ? A SER 56 39 3 Y 1 A GLU 61 ? A GLU 57 40 3 Y 1 A GLU 62 ? A GLU 58 41 3 Y 1 A ASP 63 ? A ASP 59 42 3 Y 1 A LEU 64 ? A LEU 60 43 3 Y 1 A HIS 65 ? A HIS 61 44 3 Y 1 A HIS 66 ? A HIS 62 45 3 Y 1 A HIS 67 ? A HIS 63 46 3 Y 1 A HIS 68 ? A HIS 64 47 3 Y 1 A HIS 69 ? A HIS 65 48 3 Y 1 A HIS 70 ? A HIS 66 49 4 Y 1 A GLU 55 ? A GLU 51 50 4 Y 1 A GLN 56 ? A GLN 52 51 4 Y 1 A LYS 57 ? A LYS 53 52 4 Y 1 A LEU 58 ? A LEU 54 53 4 Y 1 A ILE 59 ? A ILE 55 54 4 Y 1 A SER 60 ? A SER 56 55 4 Y 1 A GLU 61 ? A GLU 57 56 4 Y 1 A GLU 62 ? A GLU 58 57 4 Y 1 A ASP 63 ? A ASP 59 58 4 Y 1 A LEU 64 ? A LEU 60 59 4 Y 1 A HIS 65 ? A HIS 61 60 4 Y 1 A HIS 66 ? A HIS 62 61 4 Y 1 A HIS 67 ? A HIS 63 62 4 Y 1 A HIS 68 ? A HIS 64 63 4 Y 1 A HIS 69 ? A HIS 65 64 4 Y 1 A HIS 70 ? A HIS 66 65 5 Y 1 A GLU 55 ? A GLU 51 66 5 Y 1 A GLN 56 ? A GLN 52 67 5 Y 1 A LYS 57 ? A LYS 53 68 5 Y 1 A LEU 58 ? A LEU 54 69 5 Y 1 A ILE 59 ? A ILE 55 70 5 Y 1 A SER 60 ? A SER 56 71 5 Y 1 A GLU 61 ? A GLU 57 72 5 Y 1 A GLU 62 ? A GLU 58 73 5 Y 1 A ASP 63 ? A ASP 59 74 5 Y 1 A LEU 64 ? A LEU 60 75 5 Y 1 A HIS 65 ? A HIS 61 76 5 Y 1 A HIS 66 ? A HIS 62 77 5 Y 1 A HIS 67 ? A HIS 63 78 5 Y 1 A HIS 68 ? A HIS 64 79 5 Y 1 A HIS 69 ? A HIS 65 80 5 Y 1 A HIS 70 ? A HIS 66 81 6 Y 1 A GLU 55 ? A GLU 51 82 6 Y 1 A GLN 56 ? A GLN 52 83 6 Y 1 A LYS 57 ? A LYS 53 84 6 Y 1 A LEU 58 ? A LEU 54 85 6 Y 1 A ILE 59 ? A ILE 55 86 6 Y 1 A SER 60 ? A SER 56 87 6 Y 1 A GLU 61 ? A GLU 57 88 6 Y 1 A GLU 62 ? A GLU 58 89 6 Y 1 A ASP 63 ? A ASP 59 90 6 Y 1 A LEU 64 ? A LEU 60 91 6 Y 1 A HIS 65 ? A HIS 61 92 6 Y 1 A HIS 66 ? A HIS 62 93 6 Y 1 A HIS 67 ? A HIS 63 94 6 Y 1 A HIS 68 ? A HIS 64 95 6 Y 1 A HIS 69 ? A HIS 65 96 6 Y 1 A HIS 70 ? A HIS 66 97 7 Y 1 A GLU 55 ? A GLU 51 98 7 Y 1 A GLN 56 ? A GLN 52 99 7 Y 1 A LYS 57 ? A LYS 53 100 7 Y 1 A LEU 58 ? A LEU 54 101 7 Y 1 A ILE 59 ? A ILE 55 102 7 Y 1 A SER 60 ? A SER 56 103 7 Y 1 A GLU 61 ? A GLU 57 104 7 Y 1 A GLU 62 ? A GLU 58 105 7 Y 1 A ASP 63 ? A ASP 59 106 7 Y 1 A LEU 64 ? A LEU 60 107 7 Y 1 A HIS 65 ? A HIS 61 108 7 Y 1 A HIS 66 ? A HIS 62 109 7 Y 1 A HIS 67 ? A HIS 63 110 7 Y 1 A HIS 68 ? A HIS 64 111 7 Y 1 A HIS 69 ? A HIS 65 112 7 Y 1 A HIS 70 ? A HIS 66 113 8 Y 1 A GLU 55 ? A GLU 51 114 8 Y 1 A GLN 56 ? A GLN 52 115 8 Y 1 A LYS 57 ? A LYS 53 116 8 Y 1 A LEU 58 ? A LEU 54 117 8 Y 1 A ILE 59 ? A ILE 55 118 8 Y 1 A SER 60 ? A SER 56 119 8 Y 1 A GLU 61 ? A GLU 57 120 8 Y 1 A GLU 62 ? A GLU 58 121 8 Y 1 A ASP 63 ? A ASP 59 122 8 Y 1 A LEU 64 ? A LEU 60 123 8 Y 1 A HIS 65 ? A HIS 61 124 8 Y 1 A HIS 66 ? A HIS 62 125 8 Y 1 A HIS 67 ? A HIS 63 126 8 Y 1 A HIS 68 ? A HIS 64 127 8 Y 1 A HIS 69 ? A HIS 65 128 8 Y 1 A HIS 70 ? A HIS 66 129 9 Y 1 A GLU 55 ? A GLU 51 130 9 Y 1 A GLN 56 ? A GLN 52 131 9 Y 1 A LYS 57 ? A LYS 53 132 9 Y 1 A LEU 58 ? A LEU 54 133 9 Y 1 A ILE 59 ? A ILE 55 134 9 Y 1 A SER 60 ? A SER 56 135 9 Y 1 A GLU 61 ? A GLU 57 136 9 Y 1 A GLU 62 ? A GLU 58 137 9 Y 1 A ASP 63 ? A ASP 59 138 9 Y 1 A LEU 64 ? A LEU 60 139 9 Y 1 A HIS 65 ? A HIS 61 140 9 Y 1 A HIS 66 ? A HIS 62 141 9 Y 1 A HIS 67 ? A HIS 63 142 9 Y 1 A HIS 68 ? A HIS 64 143 9 Y 1 A HIS 69 ? A HIS 65 144 9 Y 1 A HIS 70 ? A HIS 66 145 10 Y 1 A GLU 55 ? A GLU 51 146 10 Y 1 A GLN 56 ? A GLN 52 147 10 Y 1 A LYS 57 ? A LYS 53 148 10 Y 1 A LEU 58 ? A LEU 54 149 10 Y 1 A ILE 59 ? A ILE 55 150 10 Y 1 A SER 60 ? A SER 56 151 10 Y 1 A GLU 61 ? A GLU 57 152 10 Y 1 A GLU 62 ? A GLU 58 153 10 Y 1 A ASP 63 ? A ASP 59 154 10 Y 1 A LEU 64 ? A LEU 60 155 10 Y 1 A HIS 65 ? A HIS 61 156 10 Y 1 A HIS 66 ? A HIS 62 157 10 Y 1 A HIS 67 ? A HIS 63 158 10 Y 1 A HIS 68 ? A HIS 64 159 10 Y 1 A HIS 69 ? A HIS 65 160 10 Y 1 A HIS 70 ? A HIS 66 161 11 Y 1 A GLU 55 ? A GLU 51 162 11 Y 1 A GLN 56 ? A GLN 52 163 11 Y 1 A LYS 57 ? A LYS 53 164 11 Y 1 A LEU 58 ? A LEU 54 165 11 Y 1 A ILE 59 ? A ILE 55 166 11 Y 1 A SER 60 ? A SER 56 167 11 Y 1 A GLU 61 ? A GLU 57 168 11 Y 1 A GLU 62 ? A GLU 58 169 11 Y 1 A ASP 63 ? A ASP 59 170 11 Y 1 A LEU 64 ? A LEU 60 171 11 Y 1 A HIS 65 ? A HIS 61 172 11 Y 1 A HIS 66 ? A HIS 62 173 11 Y 1 A HIS 67 ? A HIS 63 174 11 Y 1 A HIS 68 ? A HIS 64 175 11 Y 1 A HIS 69 ? A HIS 65 176 11 Y 1 A HIS 70 ? A HIS 66 177 12 Y 1 A GLU 55 ? A GLU 51 178 12 Y 1 A GLN 56 ? A GLN 52 179 12 Y 1 A LYS 57 ? A LYS 53 180 12 Y 1 A LEU 58 ? A LEU 54 181 12 Y 1 A ILE 59 ? A ILE 55 182 12 Y 1 A SER 60 ? A SER 56 183 12 Y 1 A GLU 61 ? A GLU 57 184 12 Y 1 A GLU 62 ? A GLU 58 185 12 Y 1 A ASP 63 ? A ASP 59 186 12 Y 1 A LEU 64 ? A LEU 60 187 12 Y 1 A HIS 65 ? A HIS 61 188 12 Y 1 A HIS 66 ? A HIS 62 189 12 Y 1 A HIS 67 ? A HIS 63 190 12 Y 1 A HIS 68 ? A HIS 64 191 12 Y 1 A HIS 69 ? A HIS 65 192 12 Y 1 A HIS 70 ? A HIS 66 193 13 Y 1 A GLU 55 ? A GLU 51 194 13 Y 1 A GLN 56 ? A GLN 52 195 13 Y 1 A LYS 57 ? A LYS 53 196 13 Y 1 A LEU 58 ? A LEU 54 197 13 Y 1 A ILE 59 ? A ILE 55 198 13 Y 1 A SER 60 ? A SER 56 199 13 Y 1 A GLU 61 ? A GLU 57 200 13 Y 1 A GLU 62 ? A GLU 58 201 13 Y 1 A ASP 63 ? A ASP 59 202 13 Y 1 A LEU 64 ? A LEU 60 203 13 Y 1 A HIS 65 ? A HIS 61 204 13 Y 1 A HIS 66 ? A HIS 62 205 13 Y 1 A HIS 67 ? A HIS 63 206 13 Y 1 A HIS 68 ? A HIS 64 207 13 Y 1 A HIS 69 ? A HIS 65 208 13 Y 1 A HIS 70 ? A HIS 66 209 14 Y 1 A GLU 55 ? A GLU 51 210 14 Y 1 A GLN 56 ? A GLN 52 211 14 Y 1 A LYS 57 ? A LYS 53 212 14 Y 1 A LEU 58 ? A LEU 54 213 14 Y 1 A ILE 59 ? A ILE 55 214 14 Y 1 A SER 60 ? A SER 56 215 14 Y 1 A GLU 61 ? A GLU 57 216 14 Y 1 A GLU 62 ? A GLU 58 217 14 Y 1 A ASP 63 ? A ASP 59 218 14 Y 1 A LEU 64 ? A LEU 60 219 14 Y 1 A HIS 65 ? A HIS 61 220 14 Y 1 A HIS 66 ? A HIS 62 221 14 Y 1 A HIS 67 ? A HIS 63 222 14 Y 1 A HIS 68 ? A HIS 64 223 14 Y 1 A HIS 69 ? A HIS 65 224 14 Y 1 A HIS 70 ? A HIS 66 225 15 Y 1 A GLU 55 ? A GLU 51 226 15 Y 1 A GLN 56 ? A GLN 52 227 15 Y 1 A LYS 57 ? A LYS 53 228 15 Y 1 A LEU 58 ? A LEU 54 229 15 Y 1 A ILE 59 ? A ILE 55 230 15 Y 1 A SER 60 ? A SER 56 231 15 Y 1 A GLU 61 ? A GLU 57 232 15 Y 1 A GLU 62 ? A GLU 58 233 15 Y 1 A ASP 63 ? A ASP 59 234 15 Y 1 A LEU 64 ? A LEU 60 235 15 Y 1 A HIS 65 ? A HIS 61 236 15 Y 1 A HIS 66 ? A HIS 62 237 15 Y 1 A HIS 67 ? A HIS 63 238 15 Y 1 A HIS 68 ? A HIS 64 239 15 Y 1 A HIS 69 ? A HIS 65 240 15 Y 1 A HIS 70 ? A HIS 66 241 16 Y 1 A GLU 55 ? A GLU 51 242 16 Y 1 A GLN 56 ? A GLN 52 243 16 Y 1 A LYS 57 ? A LYS 53 244 16 Y 1 A LEU 58 ? A LEU 54 245 16 Y 1 A ILE 59 ? A ILE 55 246 16 Y 1 A SER 60 ? A SER 56 247 16 Y 1 A GLU 61 ? A GLU 57 248 16 Y 1 A GLU 62 ? A GLU 58 249 16 Y 1 A ASP 63 ? A ASP 59 250 16 Y 1 A LEU 64 ? A LEU 60 251 16 Y 1 A HIS 65 ? A HIS 61 252 16 Y 1 A HIS 66 ? A HIS 62 253 16 Y 1 A HIS 67 ? A HIS 63 254 16 Y 1 A HIS 68 ? A HIS 64 255 16 Y 1 A HIS 69 ? A HIS 65 256 16 Y 1 A HIS 70 ? A HIS 66 257 17 Y 1 A GLU 55 ? A GLU 51 258 17 Y 1 A GLN 56 ? A GLN 52 259 17 Y 1 A LYS 57 ? A LYS 53 260 17 Y 1 A LEU 58 ? A LEU 54 261 17 Y 1 A ILE 59 ? A ILE 55 262 17 Y 1 A SER 60 ? A SER 56 263 17 Y 1 A GLU 61 ? A GLU 57 264 17 Y 1 A GLU 62 ? A GLU 58 265 17 Y 1 A ASP 63 ? A ASP 59 266 17 Y 1 A LEU 64 ? A LEU 60 267 17 Y 1 A HIS 65 ? A HIS 61 268 17 Y 1 A HIS 66 ? A HIS 62 269 17 Y 1 A HIS 67 ? A HIS 63 270 17 Y 1 A HIS 68 ? A HIS 64 271 17 Y 1 A HIS 69 ? A HIS 65 272 17 Y 1 A HIS 70 ? A HIS 66 273 18 Y 1 A GLU 55 ? A GLU 51 274 18 Y 1 A GLN 56 ? A GLN 52 275 18 Y 1 A LYS 57 ? A LYS 53 276 18 Y 1 A LEU 58 ? A LEU 54 277 18 Y 1 A ILE 59 ? A ILE 55 278 18 Y 1 A SER 60 ? A SER 56 279 18 Y 1 A GLU 61 ? A GLU 57 280 18 Y 1 A GLU 62 ? A GLU 58 281 18 Y 1 A ASP 63 ? A ASP 59 282 18 Y 1 A LEU 64 ? A LEU 60 283 18 Y 1 A HIS 65 ? A HIS 61 284 18 Y 1 A HIS 66 ? A HIS 62 285 18 Y 1 A HIS 67 ? A HIS 63 286 18 Y 1 A HIS 68 ? A HIS 64 287 18 Y 1 A HIS 69 ? A HIS 65 288 18 Y 1 A HIS 70 ? A HIS 66 289 19 Y 1 A GLU 55 ? A GLU 51 290 19 Y 1 A GLN 56 ? A GLN 52 291 19 Y 1 A LYS 57 ? A LYS 53 292 19 Y 1 A LEU 58 ? A LEU 54 293 19 Y 1 A ILE 59 ? A ILE 55 294 19 Y 1 A SER 60 ? A SER 56 295 19 Y 1 A GLU 61 ? A GLU 57 296 19 Y 1 A GLU 62 ? A GLU 58 297 19 Y 1 A ASP 63 ? A ASP 59 298 19 Y 1 A LEU 64 ? A LEU 60 299 19 Y 1 A HIS 65 ? A HIS 61 300 19 Y 1 A HIS 66 ? A HIS 62 301 19 Y 1 A HIS 67 ? A HIS 63 302 19 Y 1 A HIS 68 ? A HIS 64 303 19 Y 1 A HIS 69 ? A HIS 65 304 19 Y 1 A HIS 70 ? A HIS 66 305 20 Y 1 A GLU 55 ? A GLU 51 306 20 Y 1 A GLN 56 ? A GLN 52 307 20 Y 1 A LYS 57 ? A LYS 53 308 20 Y 1 A LEU 58 ? A LEU 54 309 20 Y 1 A ILE 59 ? A ILE 55 310 20 Y 1 A SER 60 ? A SER 56 311 20 Y 1 A GLU 61 ? A GLU 57 312 20 Y 1 A GLU 62 ? A GLU 58 313 20 Y 1 A ASP 63 ? A ASP 59 314 20 Y 1 A LEU 64 ? A LEU 60 315 20 Y 1 A HIS 65 ? A HIS 61 316 20 Y 1 A HIS 66 ? A HIS 62 317 20 Y 1 A HIS 67 ? A HIS 63 318 20 Y 1 A HIS 68 ? A HIS 64 319 20 Y 1 A HIS 69 ? A HIS 65 320 20 Y 1 A HIS 70 ? A HIS 66 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2KN0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #