data_2KNM # _entry.id 2KNM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KNM pdb_00002knm 10.2210/pdb2knm/pdb RCSB RCSB101344 ? ? WWPDB D_1000101344 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-03-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_spectrometer 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_conn 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' pdbx_entry_details 9 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KNM _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-08-27 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2KNN _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _audit_author.name 'Rosengren, K.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'The conserved glu in the cyclotide cycloviolacin O2 has a key structural role.' _citation.journal_abbrev Chembiochem _citation.journal_volume 10 _citation.page_first 2354 _citation.page_last 2360 _citation.year 2009 _citation.journal_id_ASTM ? _citation.country GE _citation.journal_id_ISSN 1439-4227 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19735083 _citation.pdbx_database_id_DOI 10.1002/cbic.200900342 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Goransson, U.' 1 ? primary 'Herrmann, A.' 2 ? primary 'Burman, R.' 3 ? primary 'Haugaard-Jonsson, L.M.' 4 ? primary 'Rosengren, K.J.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description Cycloviolacin-O2 _entity.formula_weight 3167.770 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GIPCGESCVWIPCISSAIGCSCKSKVCYRN _entity_poly.pdbx_seq_one_letter_code_can GIPCGESCVWIPCISSAIGCSCKSKVCYRN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 PRO n 1 4 CYS n 1 5 GLY n 1 6 GLU n 1 7 SER n 1 8 CYS n 1 9 VAL n 1 10 TRP n 1 11 ILE n 1 12 PRO n 1 13 CYS n 1 14 ILE n 1 15 SER n 1 16 SER n 1 17 ALA n 1 18 ILE n 1 19 GLY n 1 20 CYS n 1 21 SER n 1 22 CYS n 1 23 LYS n 1 24 SER n 1 25 LYS n 1 26 VAL n 1 27 CYS n 1 28 TYR n 1 29 ARG n 1 30 ASN n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'Sweet violet' _entity_src_nat.pdbx_organism_scientific 'Viola odorata' _entity_src_nat.pdbx_ncbi_taxonomy_id 97441 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 TRP 10 10 10 TRP TRP A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ASN 30 30 30 ASN ASN A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;NMR solution structure of the cytotoxic cyclotide cycloviolacin O2 isolated from Viola odorata. This peptide is naturally head-to-tail cyclic, i.e. has a peptide bond between the N- and C-termini. ; _exptl.entry_id 2KNM _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KNM _struct.title 'Solution structure of the cyclotide cycloviolacin O2' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KNM _struct_keywords.pdbx_keywords 'PLANT PROTEIN' _struct_keywords.text 'cyclotide, cyclic cystine knot, circular protein, Cytolysis, Disulfide bond, Hemolysis, Knottin, Plant defense, PLANT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYO2_VIOOD _struct_ref.pdbx_db_accession P58434 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GIPCGESCVWIPCISSAIGCSCKSKVCYRN _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KNM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P58434 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 30 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 30 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 13 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 19 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 13 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 19 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 20 SG ? ? A CYS 4 A CYS 20 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf2 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 8 A CYS 22 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf3 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 13 A CYS 27 1_555 ? ? ? ? ? ? ? 2.028 ? ? covale1 covale both ? A GLY 1 N ? ? ? 1_555 A ASN 30 C ? ? A GLY 1 A ASN 30 1_555 ? ? ? ? ? ? ? 1.330 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 4 ? CYS A 20 ? CYS A 4 ? 1_555 CYS A 20 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 8 ? CYS A 22 ? CYS A 8 ? 1_555 CYS A 22 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 13 ? CYS A 27 ? CYS A 13 ? 1_555 CYS A 27 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 GLY A 1 ? ASN A 30 ? GLY A 1 ? 1_555 ASN A 30 ? 1_555 N C . . . None 'Non-standard linkage' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 2 ? SER A 7 ? ILE A 2 SER A 7 A 2 VAL A 26 ? ARG A 29 ? VAL A 26 ARG A 29 A 3 SER A 21 ? LYS A 23 ? SER A 21 LYS A 23 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N CYS A 4 ? N CYS A 4 O CYS A 27 ? O CYS A 27 A 2 3 O TYR A 28 ? O TYR A 28 N SER A 21 ? N SER A 21 # _pdbx_entry_details.entry_id 2KNM _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 OE2 A GLU 6 ? ? HG A SER 15 ? ? 1.57 2 5 OE1 A GLU 6 ? ? HG A SER 15 ? ? 1.54 3 10 OE1 A GLU 6 ? ? HG A SER 15 ? ? 1.57 4 12 OE1 A GLU 6 ? ? HG A SER 15 ? ? 1.54 5 13 OE1 A GLU 6 ? ? HG A SER 15 ? ? 1.60 6 18 OE1 A GLU 6 ? ? HG A SER 15 ? ? 1.59 7 19 OE1 A GLU 6 ? ? HG A SER 15 ? ? 1.55 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 8 ? ? -73.61 41.63 2 1 CYS A 13 ? ? -69.76 95.36 3 3 ILE A 11 ? ? -170.22 135.29 4 3 LYS A 25 ? ? 82.74 -16.72 5 4 SER A 15 ? ? -59.45 -7.43 6 5 CYS A 8 ? ? -75.67 25.89 7 5 LYS A 25 ? ? 73.75 -5.82 8 6 LYS A 25 ? ? 77.95 -16.97 9 7 LYS A 25 ? ? 81.17 -18.34 10 8 SER A 15 ? ? -63.51 0.25 11 9 CYS A 13 ? ? -58.27 103.94 12 9 SER A 15 ? ? -64.30 2.65 13 10 CYS A 13 ? ? -59.47 99.56 14 10 LYS A 25 ? ? 76.10 -14.52 15 11 CYS A 8 ? ? -76.98 37.12 16 12 ILE A 11 ? ? -177.72 141.82 17 13 CYS A 13 ? ? -59.33 103.12 18 14 CYS A 13 ? ? -58.84 99.43 19 15 CYS A 8 ? ? -75.69 36.99 20 15 TRP A 10 ? ? -130.88 -35.50 21 15 LYS A 25 ? ? 76.22 -12.36 22 16 LYS A 23 ? ? -121.83 -155.95 23 16 SER A 24 ? ? -45.50 79.25 24 17 CYS A 13 ? ? -52.95 98.06 25 19 CYS A 13 ? ? -56.73 98.47 26 20 SER A 15 ? ? -63.84 4.42 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KNM _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.273 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KNM _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1-2 mM cycloviolacin O2, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1-2 mM cycloviolacin O2, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'cycloviolacin O2-1' ? 1-2 mM ? 1 'cycloviolacin O2-2' ? 1-2 mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.1 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D DQF-COSY' 1 3 1 '2D 1H-1H NOESY' 1 4 2 '2D 1H-1H TOCSY' 1 5 2 '2D 1H-1H NOESY' 1 6 1 '2D 1H-1H TOCSY' 1 7 1 '2D 1H-1H NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KNM _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 32 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 155 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 0 _pdbx_nmr_constraints.NOE_long_range_total_count 38 _pdbx_nmr_constraints.NOE_medium_range_total_count 31 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 86 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 9 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 14 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 0 # _pdbx_nmr_refine.entry_id 2KNM _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;Structures were calculated using torsion angle dynamics within CNS and subsequently refined and energy minimised using cartesian dynamics in explicit water. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VNMR 6.1 1 Varian processing VNMR 6.1 2 'Keller and Wuthrich' 'data analysis' CARA ? 3 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 4 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.0 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLU N N N N 72 GLU CA C N S 73 GLU C C N N 74 GLU O O N N 75 GLU CB C N N 76 GLU CG C N N 77 GLU CD C N N 78 GLU OE1 O N N 79 GLU OE2 O N N 80 GLU OXT O N N 81 GLU H H N N 82 GLU H2 H N N 83 GLU HA H N N 84 GLU HB2 H N N 85 GLU HB3 H N N 86 GLU HG2 H N N 87 GLU HG3 H N N 88 GLU HE2 H N N 89 GLU HXT H N N 90 GLY N N N N 91 GLY CA C N N 92 GLY C C N N 93 GLY O O N N 94 GLY OXT O N N 95 GLY H H N N 96 GLY H2 H N N 97 GLY HA2 H N N 98 GLY HA3 H N N 99 GLY HXT H N N 100 ILE N N N N 101 ILE CA C N S 102 ILE C C N N 103 ILE O O N N 104 ILE CB C N S 105 ILE CG1 C N N 106 ILE CG2 C N N 107 ILE CD1 C N N 108 ILE OXT O N N 109 ILE H H N N 110 ILE H2 H N N 111 ILE HA H N N 112 ILE HB H N N 113 ILE HG12 H N N 114 ILE HG13 H N N 115 ILE HG21 H N N 116 ILE HG22 H N N 117 ILE HG23 H N N 118 ILE HD11 H N N 119 ILE HD12 H N N 120 ILE HD13 H N N 121 ILE HXT H N N 122 LYS N N N N 123 LYS CA C N S 124 LYS C C N N 125 LYS O O N N 126 LYS CB C N N 127 LYS CG C N N 128 LYS CD C N N 129 LYS CE C N N 130 LYS NZ N N N 131 LYS OXT O N N 132 LYS H H N N 133 LYS H2 H N N 134 LYS HA H N N 135 LYS HB2 H N N 136 LYS HB3 H N N 137 LYS HG2 H N N 138 LYS HG3 H N N 139 LYS HD2 H N N 140 LYS HD3 H N N 141 LYS HE2 H N N 142 LYS HE3 H N N 143 LYS HZ1 H N N 144 LYS HZ2 H N N 145 LYS HZ3 H N N 146 LYS HXT H N N 147 PRO N N N N 148 PRO CA C N S 149 PRO C C N N 150 PRO O O N N 151 PRO CB C N N 152 PRO CG C N N 153 PRO CD C N N 154 PRO OXT O N N 155 PRO H H N N 156 PRO HA H N N 157 PRO HB2 H N N 158 PRO HB3 H N N 159 PRO HG2 H N N 160 PRO HG3 H N N 161 PRO HD2 H N N 162 PRO HD3 H N N 163 PRO HXT H N N 164 SER N N N N 165 SER CA C N S 166 SER C C N N 167 SER O O N N 168 SER CB C N N 169 SER OG O N N 170 SER OXT O N N 171 SER H H N N 172 SER H2 H N N 173 SER HA H N N 174 SER HB2 H N N 175 SER HB3 H N N 176 SER HG H N N 177 SER HXT H N N 178 TRP N N N N 179 TRP CA C N S 180 TRP C C N N 181 TRP O O N N 182 TRP CB C N N 183 TRP CG C Y N 184 TRP CD1 C Y N 185 TRP CD2 C Y N 186 TRP NE1 N Y N 187 TRP CE2 C Y N 188 TRP CE3 C Y N 189 TRP CZ2 C Y N 190 TRP CZ3 C Y N 191 TRP CH2 C Y N 192 TRP OXT O N N 193 TRP H H N N 194 TRP H2 H N N 195 TRP HA H N N 196 TRP HB2 H N N 197 TRP HB3 H N N 198 TRP HD1 H N N 199 TRP HE1 H N N 200 TRP HE3 H N N 201 TRP HZ2 H N N 202 TRP HZ3 H N N 203 TRP HH2 H N N 204 TRP HXT H N N 205 TYR N N N N 206 TYR CA C N S 207 TYR C C N N 208 TYR O O N N 209 TYR CB C N N 210 TYR CG C Y N 211 TYR CD1 C Y N 212 TYR CD2 C Y N 213 TYR CE1 C Y N 214 TYR CE2 C Y N 215 TYR CZ C Y N 216 TYR OH O N N 217 TYR OXT O N N 218 TYR H H N N 219 TYR H2 H N N 220 TYR HA H N N 221 TYR HB2 H N N 222 TYR HB3 H N N 223 TYR HD1 H N N 224 TYR HD2 H N N 225 TYR HE1 H N N 226 TYR HE2 H N N 227 TYR HH H N N 228 TYR HXT H N N 229 VAL N N N N 230 VAL CA C N S 231 VAL C C N N 232 VAL O O N N 233 VAL CB C N N 234 VAL CG1 C N N 235 VAL CG2 C N N 236 VAL OXT O N N 237 VAL H H N N 238 VAL H2 H N N 239 VAL HA H N N 240 VAL HB H N N 241 VAL HG11 H N N 242 VAL HG12 H N N 243 VAL HG13 H N N 244 VAL HG21 H N N 245 VAL HG22 H N N 246 VAL HG23 H N N 247 VAL HXT H N N 248 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLU N CA sing N N 68 GLU N H sing N N 69 GLU N H2 sing N N 70 GLU CA C sing N N 71 GLU CA CB sing N N 72 GLU CA HA sing N N 73 GLU C O doub N N 74 GLU C OXT sing N N 75 GLU CB CG sing N N 76 GLU CB HB2 sing N N 77 GLU CB HB3 sing N N 78 GLU CG CD sing N N 79 GLU CG HG2 sing N N 80 GLU CG HG3 sing N N 81 GLU CD OE1 doub N N 82 GLU CD OE2 sing N N 83 GLU OE2 HE2 sing N N 84 GLU OXT HXT sing N N 85 GLY N CA sing N N 86 GLY N H sing N N 87 GLY N H2 sing N N 88 GLY CA C sing N N 89 GLY CA HA2 sing N N 90 GLY CA HA3 sing N N 91 GLY C O doub N N 92 GLY C OXT sing N N 93 GLY OXT HXT sing N N 94 ILE N CA sing N N 95 ILE N H sing N N 96 ILE N H2 sing N N 97 ILE CA C sing N N 98 ILE CA CB sing N N 99 ILE CA HA sing N N 100 ILE C O doub N N 101 ILE C OXT sing N N 102 ILE CB CG1 sing N N 103 ILE CB CG2 sing N N 104 ILE CB HB sing N N 105 ILE CG1 CD1 sing N N 106 ILE CG1 HG12 sing N N 107 ILE CG1 HG13 sing N N 108 ILE CG2 HG21 sing N N 109 ILE CG2 HG22 sing N N 110 ILE CG2 HG23 sing N N 111 ILE CD1 HD11 sing N N 112 ILE CD1 HD12 sing N N 113 ILE CD1 HD13 sing N N 114 ILE OXT HXT sing N N 115 LYS N CA sing N N 116 LYS N H sing N N 117 LYS N H2 sing N N 118 LYS CA C sing N N 119 LYS CA CB sing N N 120 LYS CA HA sing N N 121 LYS C O doub N N 122 LYS C OXT sing N N 123 LYS CB CG sing N N 124 LYS CB HB2 sing N N 125 LYS CB HB3 sing N N 126 LYS CG CD sing N N 127 LYS CG HG2 sing N N 128 LYS CG HG3 sing N N 129 LYS CD CE sing N N 130 LYS CD HD2 sing N N 131 LYS CD HD3 sing N N 132 LYS CE NZ sing N N 133 LYS CE HE2 sing N N 134 LYS CE HE3 sing N N 135 LYS NZ HZ1 sing N N 136 LYS NZ HZ2 sing N N 137 LYS NZ HZ3 sing N N 138 LYS OXT HXT sing N N 139 PRO N CA sing N N 140 PRO N CD sing N N 141 PRO N H sing N N 142 PRO CA C sing N N 143 PRO CA CB sing N N 144 PRO CA HA sing N N 145 PRO C O doub N N 146 PRO C OXT sing N N 147 PRO CB CG sing N N 148 PRO CB HB2 sing N N 149 PRO CB HB3 sing N N 150 PRO CG CD sing N N 151 PRO CG HG2 sing N N 152 PRO CG HG3 sing N N 153 PRO CD HD2 sing N N 154 PRO CD HD3 sing N N 155 PRO OXT HXT sing N N 156 SER N CA sing N N 157 SER N H sing N N 158 SER N H2 sing N N 159 SER CA C sing N N 160 SER CA CB sing N N 161 SER CA HA sing N N 162 SER C O doub N N 163 SER C OXT sing N N 164 SER CB OG sing N N 165 SER CB HB2 sing N N 166 SER CB HB3 sing N N 167 SER OG HG sing N N 168 SER OXT HXT sing N N 169 TRP N CA sing N N 170 TRP N H sing N N 171 TRP N H2 sing N N 172 TRP CA C sing N N 173 TRP CA CB sing N N 174 TRP CA HA sing N N 175 TRP C O doub N N 176 TRP C OXT sing N N 177 TRP CB CG sing N N 178 TRP CB HB2 sing N N 179 TRP CB HB3 sing N N 180 TRP CG CD1 doub Y N 181 TRP CG CD2 sing Y N 182 TRP CD1 NE1 sing Y N 183 TRP CD1 HD1 sing N N 184 TRP CD2 CE2 doub Y N 185 TRP CD2 CE3 sing Y N 186 TRP NE1 CE2 sing Y N 187 TRP NE1 HE1 sing N N 188 TRP CE2 CZ2 sing Y N 189 TRP CE3 CZ3 doub Y N 190 TRP CE3 HE3 sing N N 191 TRP CZ2 CH2 doub Y N 192 TRP CZ2 HZ2 sing N N 193 TRP CZ3 CH2 sing Y N 194 TRP CZ3 HZ3 sing N N 195 TRP CH2 HH2 sing N N 196 TRP OXT HXT sing N N 197 TYR N CA sing N N 198 TYR N H sing N N 199 TYR N H2 sing N N 200 TYR CA C sing N N 201 TYR CA CB sing N N 202 TYR CA HA sing N N 203 TYR C O doub N N 204 TYR C OXT sing N N 205 TYR CB CG sing N N 206 TYR CB HB2 sing N N 207 TYR CB HB3 sing N N 208 TYR CG CD1 doub Y N 209 TYR CG CD2 sing Y N 210 TYR CD1 CE1 sing Y N 211 TYR CD1 HD1 sing N N 212 TYR CD2 CE2 doub Y N 213 TYR CD2 HD2 sing N N 214 TYR CE1 CZ doub Y N 215 TYR CE1 HE1 sing N N 216 TYR CE2 CZ sing Y N 217 TYR CE2 HE2 sing N N 218 TYR CZ OH sing N N 219 TYR OH HH sing N N 220 TYR OXT HXT sing N N 221 VAL N CA sing N N 222 VAL N H sing N N 223 VAL N H2 sing N N 224 VAL CA C sing N N 225 VAL CA CB sing N N 226 VAL CA HA sing N N 227 VAL C O doub N N 228 VAL C OXT sing N N 229 VAL CB CG1 sing N N 230 VAL CB CG2 sing N N 231 VAL CB HB sing N N 232 VAL CG1 HG11 sing N N 233 VAL CG1 HG12 sing N N 234 VAL CG1 HG13 sing N N 235 VAL CG2 HG21 sing N N 236 VAL CG2 HG22 sing N N 237 VAL CG2 HG23 sing N N 238 VAL OXT HXT sing N N 239 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Varian INOVA 1 'Varian INOVA' 500 Varian AVANCE 2 'Varian Avance' # _atom_sites.entry_id 2KNM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #