data_2KOL # _entry.id 2KOL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KOL pdb_00002kol 10.2210/pdb2kol/pdb RCSB RCSB101378 ? ? WWPDB D_1000101378 ? ? BMRB 16519 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 16519 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KOL _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-09-24 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Volkman, B.F.' 1 'Ziarek, J.J.' 2 'Peterson, F.C.' 3 'Veldkamp, C.T.' 4 # _citation.id primary _citation.title 'Solution structure of human SDF1-alpha H25R' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ziarek, J.J.' 1 ? primary 'Veldkamp, C.T.' 2 ? primary 'Peterson, F.C.' 3 ? primary 'Volkman, B.F.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Stromal cell-derived factor 1' _entity.formula_weight 7997.507 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation H25R _entity.pdbx_fragment 'SDF-1-alpha, residues 22-89' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SDF-1, hSDF-1, C-X-C motif chemokine 12, Pre-B cell growth-stimulating factor, PBSF, hIRH, SDF-1-beta(3-72), SDF-1-alpha(3-67)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KPVSLSYRCPCRFFESHVARANVKRLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK _entity_poly.pdbx_seq_one_letter_code_can KPVSLSYRCPCRFFESHVARANVKRLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 PRO n 1 3 VAL n 1 4 SER n 1 5 LEU n 1 6 SER n 1 7 TYR n 1 8 ARG n 1 9 CYS n 1 10 PRO n 1 11 CYS n 1 12 ARG n 1 13 PHE n 1 14 PHE n 1 15 GLU n 1 16 SER n 1 17 HIS n 1 18 VAL n 1 19 ALA n 1 20 ARG n 1 21 ALA n 1 22 ASN n 1 23 VAL n 1 24 LYS n 1 25 ARG n 1 26 LEU n 1 27 LYS n 1 28 ILE n 1 29 LEU n 1 30 ASN n 1 31 THR n 1 32 PRO n 1 33 ASN n 1 34 CYS n 1 35 ALA n 1 36 LEU n 1 37 GLN n 1 38 ILE n 1 39 VAL n 1 40 ALA n 1 41 ARG n 1 42 LEU n 1 43 LYS n 1 44 ASN n 1 45 ASN n 1 46 ASN n 1 47 ARG n 1 48 GLN n 1 49 VAL n 1 50 CYS n 1 51 ILE n 1 52 ASP n 1 53 PRO n 1 54 LYS n 1 55 LEU n 1 56 LYS n 1 57 TRP n 1 58 ILE n 1 59 GLN n 1 60 GLU n 1 61 TYR n 1 62 LEU n 1 63 GLU n 1 64 LYS n 1 65 ALA n 1 66 LEU n 1 67 ASN n 1 68 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CXCL12, SDF1, SDF1A, SDF1B' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'SG130099[pREP4]' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pQE30-8HT _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SDF1_HUMAN _struct_ref.pdbx_db_accession P48061 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KOL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P48061 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 89 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 68 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2KOL _struct_ref_seq_dif.mon_id ARG _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 25 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P48061 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 46 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 25 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 3 1 '3D_13C-separated_NOESY (AROMATIC)' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '3.3 mM [U-100% 13C; U-100% 15N] SDF1a H25R, 25 mM [U-99% 2H] MES, 0.02 % sodium azide, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2KOL _pdbx_nmr_refine.method ;AUTOMATED METHODS WERE USED FOR BACKBONE CHEMICAL SHIFT ASSIGNMENT AND ITERATIVE NOE REFINEMENT. FINAL STRUCTURES WERE OBTAINED BY MOLECULAR DYNAMICS IN EXPLICIT SOLVENT ; _pdbx_nmr_refine.details ;STRUCTURES ARE BASED ON A TOTAL OF 1430 NOE CONSTRAINTS (339 INTRA, 388 SEQUENTIAL, 263 MEDIUM, AND 440 LONG RANGE) AND 65 PHI AND PSI DIHEDRAL ANGLE CONSTRAINTS. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KOL _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KOL _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Bruker collection TopSpin 2.1 1 'Delagio,F. et al.' processing NMRPipe 2007 2 'Eccles, C., Guntert, P., Billeter, M., Wuthrich, K.' 'data analysis' XEASY 1.3 3 'R.W. Glaser' 'data analysis' SPSCAN 1.1.0 4 'C. Bartels' 'data analysis' GARANT 2.1 5 'Guntert, P.' 'structural calculation' CYANA 2.1 6 SCHWIETERS,C.D.,KUSZEWSKI,J.J.,TJANDRA,N.,CLORE,G.M. refinement Xplor-NIH 2.9.3 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KOL _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KOL _struct.title 'Solution structure of human SDF1-alpha H25R' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KOL _struct_keywords.pdbx_keywords CYTOKINE _struct_keywords.text 'chemokine, SDF1-alpha, Chemotaxis, Growth factor, CYTOKINE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 19 ? ALA A 21 ? ALA A 19 ALA A 21 5 ? 3 HELX_P HELX_P2 2 LEU A 55 ? LEU A 62 ? LEU A 55 LEU A 62 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 9 A CYS 34 1_555 ? ? ? ? ? ? ? 2.017 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 11 A CYS 50 1_555 ? ? ? ? ? ? ? 2.034 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 23 ? ASN A 30 ? VAL A 23 ASN A 30 A 2 LEU A 36 ? LEU A 42 ? LEU A 36 LEU A 42 A 3 GLN A 48 ? ILE A 51 ? GLN A 48 ILE A 51 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 29 ? N LEU A 29 O GLN A 37 ? O GLN A 37 A 2 3 N ALA A 40 ? N ALA A 40 O VAL A 49 ? O VAL A 49 # _atom_sites.entry_id 2KOL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 LYS 68 68 68 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-10-06 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2021-10-13 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 4 'Structure model' database_2 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'SDF1a H25R-1' 3.3 ? mM '[U-100% 13C; U-100% 15N]' 1 MES-2 25 ? mM '[U-99% 2H]' 1 'sodium azide-3' 0.02 ? % ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KOL _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1430 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 339 _pdbx_nmr_constraints.NOE_long_range_total_count 440 _pdbx_nmr_constraints.NOE_medium_range_total_count 263 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 388 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 15 OE2 A GLU 60 ? ? HZ2 A LYS 64 ? ? 1.59 2 18 HZ2 A LYS 56 ? ? OE2 A GLU 60 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 4 ? ? -105.72 76.70 2 1 LEU A 5 ? ? -100.10 74.15 3 1 CYS A 34 ? ? -119.13 -84.44 4 1 ALA A 35 ? ? 178.76 -153.60 5 1 TYR A 61 ? ? -104.34 -62.88 6 2 VAL A 3 ? ? -53.43 107.17 7 2 LEU A 5 ? ? 66.42 87.05 8 2 CYS A 34 ? ? -112.95 -143.40 9 2 ALA A 35 ? ? -130.92 -81.06 10 3 SER A 4 ? ? -155.24 84.97 11 3 PRO A 32 ? ? -68.39 38.64 12 3 ASN A 33 ? ? -152.88 -28.24 13 3 CYS A 34 ? ? -110.37 -85.61 14 3 ALA A 35 ? ? 170.62 -152.97 15 3 PRO A 53 ? ? -67.05 1.34 16 4 LEU A 5 ? ? -98.78 -77.04 17 4 ARG A 8 ? ? -150.57 15.22 18 4 CYS A 34 ? ? -117.33 -95.57 19 4 ALA A 35 ? ? -169.10 -87.83 20 4 PRO A 53 ? ? -67.42 11.45 21 4 TYR A 61 ? ? -109.67 -67.09 22 5 CYS A 34 ? ? -109.61 -87.88 23 5 ALA A 35 ? ? -170.41 -81.26 24 5 PRO A 53 ? ? -67.28 11.05 25 5 TYR A 61 ? ? -104.36 -62.75 26 6 VAL A 3 ? ? -169.95 105.27 27 6 CYS A 34 ? ? -113.81 -152.76 28 6 ALA A 35 ? ? -135.03 -83.57 29 6 TYR A 61 ? ? -120.38 -65.14 30 6 ASN A 67 ? ? -129.90 -50.91 31 7 LEU A 5 ? ? -99.69 -60.16 32 7 ALA A 35 ? ? 69.31 -78.35 33 7 PRO A 53 ? ? -68.65 0.62 34 7 TYR A 61 ? ? -103.36 -62.13 35 7 ASN A 67 ? ? -151.81 11.44 36 8 CYS A 34 ? ? -113.38 -86.39 37 8 ALA A 35 ? ? 171.55 -81.68 38 8 TYR A 61 ? ? -105.95 -65.90 39 9 VAL A 3 ? ? 62.55 76.19 40 9 CYS A 34 ? ? -111.48 -81.44 41 9 ALA A 35 ? ? -177.89 -155.53 42 9 PRO A 53 ? ? -68.26 6.72 43 9 TYR A 61 ? ? -107.12 -64.37 44 10 PRO A 2 ? ? -67.61 2.88 45 10 CYS A 34 ? ? -112.83 -92.98 46 10 ALA A 35 ? ? 174.99 -78.91 47 11 CYS A 11 ? ? -91.19 -65.06 48 11 ARG A 12 ? ? 68.83 -41.63 49 11 CYS A 34 ? ? -118.88 -84.43 50 11 ALA A 35 ? ? -177.80 -156.81 51 11 PRO A 53 ? ? -67.70 1.93 52 11 TYR A 61 ? ? -102.74 -64.41 53 12 LEU A 5 ? ? 64.97 89.41 54 12 CYS A 34 ? ? -111.35 -89.45 55 12 ALA A 35 ? ? -172.82 -151.39 56 12 TYR A 61 ? ? -106.20 -66.20 57 13 SER A 4 ? ? 68.78 101.55 58 13 CYS A 34 ? ? -125.51 -149.97 59 13 ALA A 35 ? ? -119.80 -84.44 60 13 TYR A 61 ? ? -102.74 -70.52 61 13 ASN A 67 ? ? -135.46 -57.94 62 14 SER A 4 ? ? 66.98 165.42 63 14 SER A 6 ? ? -156.67 -159.96 64 14 TYR A 7 ? ? 72.64 92.14 65 14 CYS A 34 ? ? -112.84 -81.03 66 14 ALA A 35 ? ? 178.35 -158.11 67 14 PRO A 53 ? ? -68.02 8.12 68 15 LEU A 5 ? ? -128.96 -51.19 69 15 CYS A 11 ? ? -95.05 -60.58 70 15 ARG A 12 ? ? 73.36 -46.92 71 15 CYS A 34 ? ? -111.54 -155.24 72 15 ALA A 35 ? ? -130.66 -86.16 73 15 ASN A 46 ? ? 71.06 -9.02 74 16 SER A 4 ? ? 64.17 108.79 75 16 CYS A 34 ? ? -110.52 -84.32 76 16 ALA A 35 ? ? 171.90 -79.40 77 16 TYR A 61 ? ? -105.85 -65.04 78 17 LEU A 5 ? ? -87.82 -73.94 79 17 ALA A 35 ? ? 71.09 -57.53 80 18 CYS A 34 ? ? -112.50 -146.60 81 18 ALA A 35 ? ? -134.54 -77.99 82 18 ASN A 46 ? ? 70.01 -8.62 83 18 PRO A 53 ? ? -68.64 3.30 84 18 TYR A 61 ? ? -109.38 -67.17 85 19 CYS A 34 ? ? -111.45 -150.02 86 19 ALA A 35 ? ? -108.56 -76.79 87 19 TYR A 61 ? ? -109.88 -64.65 88 20 SER A 4 ? ? 61.53 90.50 89 20 ASN A 33 ? ? -147.05 -24.44 90 20 ALA A 35 ? ? 62.19 -82.09 #