data_2KP2 # _entry.id 2KP2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KP2 pdb_00002kp2 10.2210/pdb2kp2/pdb RCSB RCSB101395 ? ? WWPDB D_1000101395 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 6971 BMRB . unspecified 2KP1 PDB ;a' domain of PDI ; # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KP2 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2009-10-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kato, K.' 1 'Yamaguchi, Y.' 2 'Serve, O.' 3 # _citation.id primary _citation.title ;Redox-Dependent Domain Rearrangement of Protein Disulfide Isomerase Coupled with Exposure of Its Substrate-Binding Hydrophobic Surface ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year 2009 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 1089-8638 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19944705 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2009.11.049 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Serve, O.' 1 ? primary 'Kamiya, Y.' 2 ? primary 'Maeno, A.' 3 ? primary 'Nakano, M.' 4 ? primary 'Murakami, C.' 5 ? primary 'Sasakawa, H.' 6 ? primary 'Yamaguchi, Y.' 7 ? primary 'Harada, T.' 8 ? primary 'Kurimoto, E.' 9 ? primary 'Yagi-Utsumi, M.' 10 ? primary 'Iguchi, T.' 11 ? primary 'Inaba, K.' 12 ? primary 'Kikuchi, J.' 13 ? primary 'Asami, O.' 14 ? primary 'Kajino, T.' 15 ? primary 'Oka, T.' 16 ? primary 'Nakasako, M.' 17 ? primary 'Kato, K.' 18 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein disulfide-isomerase' _entity.formula_weight 14505.343 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 5.3.4.1 _entity.pdbx_mutation ? _entity.pdbx_fragment ;B' Domain, UNP residues 228-355 ; _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name PDI # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSPLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNLKTDKFP AFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQEG ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSPLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNLKTDKFP AFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQEG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 PRO n 1 7 LEU n 1 8 ILE n 1 9 GLY n 1 10 GLU n 1 11 ILE n 1 12 GLY n 1 13 PRO n 1 14 GLU n 1 15 THR n 1 16 TYR n 1 17 SER n 1 18 ASP n 1 19 TYR n 1 20 MET n 1 21 SER n 1 22 ALA n 1 23 GLY n 1 24 ILE n 1 25 PRO n 1 26 LEU n 1 27 ALA n 1 28 TYR n 1 29 ILE n 1 30 PHE n 1 31 ALA n 1 32 GLU n 1 33 THR n 1 34 ALA n 1 35 GLU n 1 36 GLU n 1 37 ARG n 1 38 LYS n 1 39 GLU n 1 40 LEU n 1 41 SER n 1 42 ASP n 1 43 LYS n 1 44 LEU n 1 45 LYS n 1 46 PRO n 1 47 ILE n 1 48 ALA n 1 49 GLU n 1 50 ALA n 1 51 GLN n 1 52 ARG n 1 53 GLY n 1 54 VAL n 1 55 ILE n 1 56 ASN n 1 57 PHE n 1 58 GLY n 1 59 THR n 1 60 ILE n 1 61 ASP n 1 62 ALA n 1 63 LYS n 1 64 ALA n 1 65 PHE n 1 66 GLY n 1 67 ALA n 1 68 HIS n 1 69 ALA n 1 70 GLY n 1 71 ASN n 1 72 LEU n 1 73 ASN n 1 74 LEU n 1 75 LYS n 1 76 THR n 1 77 ASP n 1 78 LYS n 1 79 PHE n 1 80 PRO n 1 81 ALA n 1 82 PHE n 1 83 ALA n 1 84 ILE n 1 85 GLN n 1 86 GLU n 1 87 VAL n 1 88 ALA n 1 89 LYS n 1 90 ASN n 1 91 GLN n 1 92 LYS n 1 93 PHE n 1 94 PRO n 1 95 PHE n 1 96 ASP n 1 97 GLN n 1 98 GLU n 1 99 LYS n 1 100 GLU n 1 101 ILE n 1 102 THR n 1 103 PHE n 1 104 GLU n 1 105 ALA n 1 106 ILE n 1 107 LYS n 1 108 ALA n 1 109 PHE n 1 110 VAL n 1 111 ASP n 1 112 ASP n 1 113 PHE n 1 114 VAL n 1 115 ALA n 1 116 GLY n 1 117 LYS n 1 118 ILE n 1 119 GLU n 1 120 PRO n 1 121 SER n 1 122 ILE n 1 123 LYS n 1 124 SER n 1 125 GLU n 1 126 PRO n 1 127 ILE n 1 128 PRO n 1 129 GLU n 1 130 LYS n 1 131 GLN n 1 132 GLU n 1 133 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Humicola insolens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 34413 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant DE3 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX6P-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PDI_HUMIN _struct_ref.pdbx_db_accession P55059 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNLKTDKFPAFAIQ EVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQEG ; _struct_ref.pdbx_align_begin 228 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KP2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 133 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P55059 _struct_ref_seq.db_align_beg 228 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 355 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 6 _struct_ref_seq.pdbx_auth_seq_align_end 133 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KP2 GLY A 1 ? UNP P55059 ? ? 'expression tag' 1 1 1 2KP2 PRO A 2 ? UNP P55059 ? ? 'expression tag' 2 2 1 2KP2 LEU A 3 ? UNP P55059 ? ? 'expression tag' 3 3 1 2KP2 GLY A 4 ? UNP P55059 ? ? 'expression tag' 4 4 1 2KP2 SER A 5 ? UNP P55059 ? ? 'expression tag' 5 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '2D 1H-1H NOESY' 1 2 2 '3D 1H-15N NOESY' 1 3 2 '3D 1H-13C NOESY' 1 4 1 '2D 1H-15N HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.16 _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1.0mM [U-15N] PDI B'-1, 10mM sodium phosphate-2, 100mM potassium chloride-3, 10mM DTT-4, 99 % D2O ; 1 '99% D2O' ;1.0mM [U-13C; U-15N] PDI B'-5, 10mM sodium phosphate-6, 100mM potassium chloride-7, 10mM DTT-8, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker DRX 1 'BRUKER DRX' 920 JEOL ECA 2 'JEOL ECA' # _pdbx_nmr_refine.entry_id 2KP2 _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KP2 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 11.30 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 1.5 _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KP2 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection XwinNMR 2.6 1 'Bruker Biospin' processing XwinNMR 2.6 2 JEOL collection Delta 4.3.3 3 JEOL processing Delta 4.3.3 4 Goddard 'chemical shift assignment' Sparky 3.1 5 Goddard 'peak picking' Sparky 3.1 6 'Guntert, Mumenthaler, Wuthrich' 'chemical shift assignment' CYANA 2.1 7 'Guntert, Mumenthaler, Wuthrich' 'structure solution' CYANA 2.1 8 'Brunger, Adams, Clore, Gros, Nilges, Read' refinement CNS 1.2 9 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KP2 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KP2 _struct.title ;Solution structure of the b' domain of thermophilic fungal protein disulfide isomerase ; _struct.pdbx_model_details 'fewest violations, model 10' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KP2 _struct_keywords.pdbx_keywords ISOMERASE _struct_keywords.text 'THIOREDOXIN FOLD, ISOMERASE, Disulfide bond, Endoplasmic reticulum, Redox-active center' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 15 ? SER A 21 ? THR A 15 SER A 21 1 ? 7 HELX_P HELX_P2 2 GLU A 36 ? ALA A 50 ? GLU A 36 ALA A 50 1 ? 15 HELX_P HELX_P3 3 PHE A 65 ? ALA A 67 ? PHE A 65 ALA A 67 5 ? 3 HELX_P HELX_P4 4 HIS A 68 ? ASN A 73 ? HIS A 68 ASN A 73 1 ? 6 HELX_P HELX_P5 5 THR A 102 ? ALA A 115 ? THR A 102 ALA A 115 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 8 ? GLU A 10 ? ILE A 8 GLU A 10 A 2 ASN A 56 ? ASP A 61 ? ASN A 56 ASP A 61 A 3 LEU A 26 ? ALA A 31 ? LEU A 26 ALA A 31 A 4 ALA A 81 ? GLN A 85 ? ALA A 81 GLN A 85 A 5 LYS A 92 ? PRO A 94 ? LYS A 92 PRO A 94 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 9 ? N GLY A 9 O THR A 59 ? O THR A 59 A 2 3 O ASN A 56 ? O ASN A 56 N ALA A 27 ? N ALA A 27 A 3 4 N LEU A 26 ? N LEU A 26 O GLN A 85 ? O GLN A 85 A 4 5 N ILE A 84 ? N ILE A 84 O PHE A 93 ? O PHE A 93 # _atom_sites.entry_id 2KP2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 GLY 133 133 133 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-10-27 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.07 _pdbx_nmr_ensemble_rms.distance_rms_dev_error ? _pdbx_nmr_ensemble_rms.entry_id 2KP2 _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id ;PDI B'-1 ; 1.0 ? mM '[U-15N]' 1 'sodium phosphate-2' 10 ? mM ? 1 'potassium chloride-3' 100 ? mM ? 1 DTT-4 10 ? mM ? 1 ;PDI B'-5 ; 1.0 ? mM '[U-13C; U-15N]' 2 'sodium phosphate-6' 10 ? mM ? 2 'potassium chloride-7' 100 ? mM ? 2 DTT-8 10 ? mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KP2 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2276 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 464 _pdbx_nmr_constraints.NOE_long_range_total_count 780 _pdbx_nmr_constraints.NOE_medium_range_total_count 405 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 627 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 70 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 70 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 OD2 A ASP 77 ? ? HZ2 A LYS 78 ? ? 1.59 2 7 OD1 A ASP 112 ? ? HZ1 A LYS 117 ? ? 1.60 3 9 OD1 A ASP 61 ? ? H A PHE 65 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 51 ? ? -145.32 33.96 2 1 ASN A 73 ? ? -176.35 -52.19 3 1 THR A 76 ? ? 56.43 17.41 4 1 LYS A 78 ? ? -123.49 -165.29 5 1 LYS A 99 ? ? -113.63 -89.53 6 1 GLU A 100 ? ? 176.39 127.33 7 1 THR A 102 ? ? -123.42 -169.04 8 1 ILE A 122 ? ? -146.86 -110.49 9 1 LYS A 123 ? ? 66.22 109.81 10 2 GLN A 51 ? ? -147.13 36.10 11 2 VAL A 54 ? ? -138.71 -33.26 12 2 ASN A 73 ? ? -168.07 -64.89 13 2 LYS A 78 ? ? -117.84 -160.44 14 2 PHE A 79 ? ? -59.99 170.66 15 2 PRO A 80 ? ? -39.35 133.43 16 2 GLU A 98 ? ? -146.16 18.69 17 2 GLU A 100 ? ? 68.84 126.55 18 2 LYS A 123 ? ? 161.62 135.37 19 3 ASN A 73 ? ? -174.50 -56.71 20 3 LYS A 78 ? ? -117.84 -160.84 21 3 PRO A 80 ? ? -39.74 129.65 22 3 GLU A 100 ? ? 69.64 117.97 23 3 PRO A 120 ? ? -38.98 118.51 24 3 ILE A 122 ? ? -139.77 -54.08 25 3 LYS A 123 ? ? 58.11 72.58 26 3 GLU A 132 ? ? 68.89 115.77 27 4 GLN A 51 ? ? -146.64 36.28 28 4 VAL A 54 ? ? -139.77 -33.73 29 4 ASN A 73 ? ? -171.48 -60.12 30 4 LYS A 78 ? ? -106.42 -162.01 31 4 ASN A 90 ? ? 65.88 86.72 32 4 GLU A 98 ? ? -149.31 23.66 33 4 LYS A 99 ? ? -90.76 -81.79 34 4 GLU A 100 ? ? 172.45 123.63 35 4 ILE A 122 ? ? -126.83 -54.42 36 4 GLU A 129 ? ? 69.53 151.94 37 5 ASN A 73 ? ? 177.78 -60.03 38 5 LYS A 78 ? ? -119.54 -159.92 39 5 PHE A 79 ? ? -61.47 -176.37 40 5 GLU A 98 ? ? -152.22 22.02 41 5 GLU A 100 ? ? 70.49 133.02 42 5 THR A 102 ? ? -110.25 -165.93 43 5 SER A 124 ? ? -154.57 89.07 44 5 GLU A 129 ? ? -57.07 103.63 45 6 GLN A 51 ? ? -142.34 31.80 46 6 VAL A 54 ? ? -130.05 -37.47 47 6 ASN A 73 ? ? -175.80 -60.22 48 6 PHE A 79 ? ? 60.07 -171.06 49 6 GLU A 100 ? ? 66.68 117.31 50 6 ILE A 122 ? ? 179.67 -45.35 51 6 LYS A 130 ? ? 68.75 108.63 52 7 LEU A 7 ? ? -169.73 -61.21 53 7 ASN A 73 ? ? -169.23 -56.95 54 7 THR A 76 ? ? 74.70 -13.13 55 7 PHE A 79 ? ? 56.52 -175.57 56 7 ASN A 90 ? ? 59.85 80.43 57 7 GLU A 98 ? ? -142.30 22.63 58 7 SER A 121 ? ? -82.88 40.00 59 7 ILE A 122 ? ? -156.89 -82.17 60 8 SER A 5 ? ? -134.26 -65.27 61 8 PRO A 6 ? ? -107.63 50.06 62 8 GLN A 51 ? ? -148.57 35.37 63 8 VAL A 54 ? ? -138.84 -32.65 64 8 ASN A 73 ? ? -179.96 -59.63 65 8 PHE A 79 ? ? -69.16 -172.45 66 8 GLU A 100 ? ? 72.95 134.00 67 8 LYS A 123 ? ? 74.14 -157.79 68 8 SER A 124 ? ? 69.26 126.91 69 8 LYS A 130 ? ? -69.39 95.22 70 9 LEU A 3 ? ? 57.10 72.29 71 9 ASN A 73 ? ? 179.51 -56.74 72 9 THR A 76 ? ? 59.30 5.78 73 9 LYS A 78 ? ? -119.21 -158.68 74 9 GLU A 98 ? ? -154.92 20.96 75 9 GLU A 100 ? ? 74.09 120.46 76 9 THR A 102 ? ? -126.03 -164.47 77 9 PRO A 120 ? ? -51.90 108.67 78 9 ILE A 122 ? ? -138.55 -50.75 79 9 GLU A 129 ? ? 63.36 -168.33 80 10 LEU A 7 ? ? -138.93 -59.04 81 10 ASN A 73 ? ? -172.94 -57.88 82 10 PHE A 79 ? ? 60.39 179.74 83 10 ASN A 90 ? ? 56.44 75.43 84 10 GLU A 98 ? ? -148.09 32.36 85 10 GLU A 100 ? ? 74.24 127.69 86 10 ILE A 122 ? ? -147.80 -41.11 87 10 GLU A 129 ? ? 68.19 115.97 #