data_2KPI # _entry.id 2KPI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KPI pdb_00002kpi 10.2210/pdb2kpi/pdb RCSB RCSB101411 ? ? WWPDB D_1000101411 ? ? BMRB 16556 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetDB RR58 . unspecified BMRB 16556 . unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KPI _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-10-15 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ramelot, T.A.' 1 'Cort, J.R.' 2 'Garcia, M.' 3 'Yee, A.' 4 'Arrowmith, C.H.' 5 'Montelione, G.T.' 6 'Kennedy, M.A.' 7 'Northeast Structural Genomics Consortium (NESG)' 8 # _citation.id primary _citation.title ;Solution NMR structure of Streptomyces coelicolor SCO3027 modeled with Zn+2 bound, Northeast Structural Genomics Consortium Target RR58 ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ramelot, T.A.' 1 ? primary 'Cort, J.R.' 2 ? primary 'Garcia, M.' 3 ? primary 'Yee, A.' 4 ? primary 'Arrowmith, C.H.' 5 ? primary 'Montelione, G.T.' 6 ? primary 'Kennedy, M.A.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein SCO3027' 6048.983 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MPLEAGLLEILACPACHAPLEERDAELICTGQDCGLAYPVRDGIPVLLVDEARRPE _entity_poly.pdbx_seq_one_letter_code_can MPLEAGLLEILACPACHAPLEERDAELICTGQDCGLAYPVRDGIPVLLVDEARRPE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier RR58 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 LEU n 1 4 GLU n 1 5 ALA n 1 6 GLY n 1 7 LEU n 1 8 LEU n 1 9 GLU n 1 10 ILE n 1 11 LEU n 1 12 ALA n 1 13 CYS n 1 14 PRO n 1 15 ALA n 1 16 CYS n 1 17 HIS n 1 18 ALA n 1 19 PRO n 1 20 LEU n 1 21 GLU n 1 22 GLU n 1 23 ARG n 1 24 ASP n 1 25 ALA n 1 26 GLU n 1 27 LEU n 1 28 ILE n 1 29 CYS n 1 30 THR n 1 31 GLY n 1 32 GLN n 1 33 ASP n 1 34 CYS n 1 35 GLY n 1 36 LEU n 1 37 ALA n 1 38 TYR n 1 39 PRO n 1 40 VAL n 1 41 ARG n 1 42 ASP n 1 43 GLY n 1 44 ILE n 1 45 PRO n 1 46 VAL n 1 47 LEU n 1 48 LEU n 1 49 VAL n 1 50 ASP n 1 51 GLU n 1 52 ALA n 1 53 ARG n 1 54 ARG n 1 55 PRO n 1 56 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SCD84.08c, SCE34.08c, SCO3027' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces coelicolor' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1902 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) gold pMGK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector p15Tv _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9KZL7_STRCO _struct_ref.pdbx_db_accession Q9KZL7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MPLEAGLLEILACPACHAPLEERDAELICTGQDCGLAYPVRDGIPVLLVDEARRPE _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KPI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 56 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9KZL7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 56 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 56 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D 1H-15N NOESY' 1 4 1 '3D 1H-13C NOESY aliph' 1 5 1 '3D HNCO' 1 6 1 '3D CBCA(CO)NH' 1 7 1 '3D HNCACB' 1 8 1 '3D HBHA(CO)NH' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D HCCH-TOCSY' 1 11 2 '4D HCCH NOESY' 1 12 1 '3D C(CO)NH' 1 13 1 '3D H(CCO)NH' 1 14 3 '2D 1H-13C HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;10 mM Tris, 300 mM sodium chloride, 10 mM zinc chloride, 10 mM DTT, 0.01 % sodium azide, 0.9 mM [U-100% 13C; U-100% 15N] protein, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;10 mM Tris, 300 mM sodium chloride, 10 mM zinc chloride, 10 mM DTT, 0.01 % sodium azide, 0.9 mM [U-100% 13C; U-100% 15N] protein, 100% D2O ; 2 '100% D2O' ;10 mM Tris, 300 mM sodium chloride, 10 mM zinc chloride, 10 mM DTT, 0.01 % sodium azide, 0.9 mM [U-7% 13C; U-100% 15N] protein, 95% H2O/5% D2O ; 3 '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 850 Bruker 'AVANCE III' 2 'Bruker AvanceIII' 500 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KPI _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'xplor with hydrogen bond potential refinement' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KPI _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KPI _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2008 1 Varian collection VNMR 6.1C 2 'Bruker Biospin' collection TopSpin 2.1.4 3 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.2.1 4 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 2.20 5 Goddard 'data analysis' Sparky 3.113 6 'Bhattacharya and Montelione' 'structure validation' PSVS 1.3 7 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.3.0 8 '(PDBStat) R. Tejero, G.T. Montelione' 'data analysis' PdbStat 5.0 9 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 10 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'C4 zinc-binding protein' _exptl.entry_id 2KPI _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KPI _struct.title ;Solution NMR structure of Streptomyces coelicolor SCO3027 modeled with Zn+2 bound, Northeast Structural Genomics Consortium Target RR58 ; _struct.pdbx_model_details 'C4 zinc-binding protein' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KPI _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;zinc finger, PSI-2, NESG, all beta, Structural Genomics, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 13 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 13 A ZN 150 1_555 ? ? ? ? ? ? ? 2.235 ? ? metalc2 metalc ? ? A CYS 16 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 16 A ZN 150 1_555 ? ? ? ? ? ? ? 2.235 ? ? metalc3 metalc ? ? A CYS 29 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 29 A ZN 150 1_555 ? ? ? ? ? ? ? 2.237 ? ? metalc4 metalc ? ? A CYS 34 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 34 A ZN 150 1_555 ? ? ? ? ? ? ? 2.236 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 20 ? ARG A 23 ? LEU A 20 ARG A 23 A 2 GLU A 26 ? CYS A 29 ? GLU A 26 CYS A 29 A 3 ALA A 37 ? ARG A 41 ? ALA A 37 ARG A 41 A 4 ILE A 44 ? PRO A 45 ? ILE A 44 PRO A 45 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 21 ? N GLU A 21 O ILE A 28 ? O ILE A 28 A 2 3 N LEU A 27 ? N LEU A 27 O TYR A 38 ? O TYR A 38 A 3 4 N ARG A 41 ? N ARG A 41 O ILE A 44 ? O ILE A 44 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 150 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 150' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 13 ? CYS A 13 . ? 1_555 ? 2 AC1 4 CYS A 16 ? CYS A 16 . ? 1_555 ? 3 AC1 4 CYS A 29 ? CYS A 29 . ? 1_555 ? 4 AC1 4 CYS A 34 ? CYS A 34 . ? 1_555 ? # _atom_sites.entry_id 2KPI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 GLU 56 56 56 GLU GLU A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 150 _pdbx_nonpoly_scheme.auth_seq_num 150 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 150 ? 1_555 SG ? A CYS 16 ? A CYS 16 ? 1_555 110.0 ? 2 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 150 ? 1_555 SG ? A CYS 29 ? A CYS 29 ? 1_555 109.5 ? 3 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 150 ? 1_555 SG ? A CYS 29 ? A CYS 29 ? 1_555 109.2 ? 4 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? B ZN . ? A ZN 150 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 108.7 ? 5 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 150 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 109.4 ? 6 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? B ZN . ? A ZN 150 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 110.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-02-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' pdbx_struct_assembly 6 3 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_database_status 9 4 'Structure model' pdbx_struct_conn_angle 10 4 'Structure model' struct_conn 11 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.value' 12 4 'Structure model' '_struct_conn.pdbx_dist_value' 13 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 14 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 15 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 16 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 17 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Tris 10 mM ? 1 'sodium chloride' 300 mM ? 1 'zinc chloride' 10 mM ? 1 DTT 10 mM ? 1 'sodium azide' 0.01 % ? 1 protein 0.9 mM '[U-100% 13C; U-100% 15N]' 1 Tris 10 mM ? 2 'sodium chloride' 300 mM ? 2 'zinc chloride' 10 mM ? 2 DTT 10 mM ? 2 'sodium azide' 0.01 % ? 2 protein 0.9 mM '[U-100% 13C; U-100% 15N]' 2 Tris 10 mM ? 3 'sodium chloride' 300 mM ? 3 'zinc chloride' 10 mM ? 3 DTT 10 mM ? 3 'sodium azide' 0.01 % ? 3 protein 0.9 mM '[U-7% 13C; U-100% 15N]' 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 5 ? ? -122.13 -65.88 2 1 LEU A 7 ? ? 55.01 111.96 3 1 HIS A 17 ? ? -37.89 112.43 4 1 ASP A 24 ? ? 50.80 -112.93 5 2 GLU A 9 ? ? 49.07 99.05 6 2 ILE A 10 ? ? 54.63 111.21 7 2 ALA A 15 ? ? 45.27 15.31 8 2 CYS A 16 ? ? -172.86 123.40 9 2 LEU A 47 ? ? -77.24 45.58 10 3 GLU A 4 ? ? -84.83 -88.10 11 3 ALA A 5 ? ? 57.07 156.13 12 3 ALA A 15 ? ? 79.87 -36.94 13 3 CYS A 16 ? ? -122.70 -169.09 14 3 ASP A 24 ? ? 49.74 -113.68 15 3 CYS A 34 ? ? -129.46 -145.09 16 3 ARG A 54 ? ? -49.21 167.51 17 4 LEU A 3 ? ? 59.01 123.67 18 4 LEU A 7 ? ? 50.13 105.43 19 4 ILE A 10 ? ? -109.81 -164.03 20 4 ALA A 15 ? ? 69.41 -69.45 21 4 HIS A 17 ? ? 52.63 88.82 22 4 ASP A 24 ? ? 40.20 -116.80 23 5 LEU A 3 ? ? -157.14 -35.34 24 5 LEU A 8 ? ? -83.28 -76.65 25 5 GLU A 9 ? ? 43.87 96.39 26 5 ALA A 15 ? ? 66.75 -61.17 27 5 ASP A 24 ? ? 52.82 -96.53 28 5 CYS A 34 ? ? -142.32 -150.57 29 6 PRO A 2 ? ? -60.02 5.61 30 6 LEU A 3 ? ? -72.73 -79.79 31 6 GLU A 4 ? ? 55.08 -82.41 32 6 LEU A 7 ? ? -74.92 -78.26 33 6 GLU A 9 ? ? -55.32 -173.07 34 6 ALA A 15 ? ? 76.41 -35.76 35 6 CYS A 16 ? ? -124.95 -166.27 36 6 ALA A 18 ? ? 164.61 158.76 37 6 PRO A 19 ? ? -56.97 177.41 38 6 ASP A 24 ? ? 54.00 -94.62 39 6 LEU A 36 ? ? 41.20 111.57 40 6 ASP A 42 ? ? 56.78 5.66 41 7 GLU A 4 ? ? -142.19 -28.69 42 7 LEU A 7 ? ? 76.86 -59.82 43 7 LEU A 8 ? ? 44.73 -107.55 44 7 ALA A 15 ? ? 68.92 -53.56 45 7 ALA A 18 ? ? 173.60 155.39 46 7 ASP A 24 ? ? 53.62 -84.81 47 7 ALA A 25 ? ? -140.55 27.27 48 7 CYS A 34 ? ? -141.01 -112.85 49 7 LEU A 47 ? ? -93.71 35.28 50 8 GLU A 4 ? ? 40.77 -123.74 51 8 ALA A 5 ? ? -114.47 70.66 52 8 LEU A 7 ? ? 56.31 116.34 53 8 LEU A 8 ? ? 38.52 -160.59 54 8 GLU A 9 ? ? 42.82 79.04 55 8 PRO A 14 ? ? -68.25 33.00 56 8 ALA A 15 ? ? -153.52 -75.86 57 8 HIS A 17 ? ? 54.59 12.00 58 8 ASP A 24 ? ? 52.47 -91.29 59 8 CYS A 34 ? ? -94.03 -70.28 60 9 GLU A 4 ? ? 47.67 78.88 61 9 PRO A 19 ? ? -49.36 163.25 62 9 ASP A 24 ? ? 52.07 -109.61 63 9 CYS A 34 ? ? -95.40 -69.22 64 10 LEU A 7 ? ? 54.09 3.95 65 10 PRO A 14 ? ? -80.23 -86.15 66 10 CYS A 16 ? ? -93.11 55.03 67 10 HIS A 17 ? ? -41.24 108.94 68 10 LEU A 36 ? ? -53.81 178.46 69 11 GLU A 4 ? ? 51.95 103.80 70 11 LEU A 8 ? ? 41.35 91.65 71 11 PRO A 14 ? ? -68.84 -79.16 72 11 ALA A 25 ? ? 37.00 35.07 73 11 CYS A 34 ? ? -102.18 -117.73 74 12 ALA A 5 ? ? -170.47 131.04 75 12 ALA A 15 ? ? 70.45 -12.59 76 12 HIS A 17 ? ? -140.95 24.97 77 12 ASP A 24 ? ? 46.50 -111.60 78 12 CYS A 34 ? ? -89.35 -79.24 79 12 LEU A 36 ? ? 24.74 111.04 80 13 LEU A 7 ? ? 56.06 111.09 81 13 LEU A 8 ? ? 46.00 99.71 82 13 ALA A 18 ? ? 176.92 158.12 83 13 ASP A 24 ? ? -38.79 103.53 84 13 LEU A 47 ? ? -81.79 42.49 85 14 PRO A 2 ? ? -69.38 -165.40 86 14 GLU A 4 ? ? -163.52 40.58 87 14 LEU A 7 ? ? 58.67 145.94 88 14 ALA A 15 ? ? -148.52 -47.22 89 14 HIS A 17 ? ? 69.90 -26.65 90 14 ALA A 18 ? ? -48.90 -178.71 91 14 ASP A 24 ? ? 51.17 -110.76 92 14 CYS A 34 ? ? -78.11 -80.56 93 14 LEU A 36 ? ? 41.98 121.21 94 14 LEU A 47 ? ? -91.78 31.65 95 15 PRO A 14 ? ? -50.26 -9.64 96 15 ALA A 15 ? ? -100.95 -72.98 97 15 HIS A 17 ? ? 55.07 88.68 98 15 ASP A 24 ? ? 53.98 -87.40 99 16 PRO A 2 ? ? -14.65 -111.17 100 16 GLU A 9 ? ? -62.42 97.71 101 16 PRO A 14 ? ? -75.23 -83.84 102 16 ASP A 24 ? ? 53.88 -90.11 103 16 ALA A 25 ? ? -141.43 28.71 104 16 PRO A 55 ? ? -38.43 136.31 105 17 GLU A 4 ? ? 44.00 -127.46 106 17 GLU A 9 ? ? 51.14 99.24 107 17 ASP A 24 ? ? -22.28 78.79 108 17 ALA A 25 ? ? 155.38 -30.89 109 17 GLU A 26 ? ? -178.08 -174.15 110 17 CYS A 34 ? ? -81.25 -114.71 111 17 LEU A 36 ? ? -9.43 125.59 112 17 LEU A 47 ? ? -85.27 39.88 113 18 LEU A 3 ? ? -170.51 114.65 114 18 PRO A 14 ? ? -70.62 -80.13 115 18 ALA A 18 ? ? 164.82 156.78 116 18 LEU A 36 ? ? 74.45 160.60 117 19 GLU A 4 ? ? -173.19 140.80 118 19 ALA A 5 ? ? -63.02 88.43 119 19 GLU A 9 ? ? 59.55 106.93 120 19 ALA A 15 ? ? -132.00 -53.25 121 19 HIS A 17 ? ? 63.31 -1.44 122 19 ASP A 24 ? ? 17.17 -85.80 123 19 ALA A 25 ? ? -141.60 29.82 124 19 LEU A 47 ? ? -80.86 38.30 125 20 LEU A 3 ? ? 54.94 -176.13 126 20 GLU A 4 ? ? 55.09 163.05 127 20 ALA A 5 ? ? -169.05 -12.67 128 20 GLU A 9 ? ? -84.49 -108.40 129 20 PRO A 14 ? ? -67.81 -79.24 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #