data_2KPM # _entry.id 2KPM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.323 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2KPM RCSB RCSB101415 BMRB 16560 WWPDB D_1000101415 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified NeR103A TargetDB . unspecified 16560 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KPM _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-10-16 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rossi, P.' 1 'Belote, R.' 2 'Jiang, M.' 3 'Xiao, R.' 4 'Ciccosanti, C.' 5 'Acton, T.' 6 'Everett, J.' 7 'Rost, B.' 8 'Montelione, G.T.' 9 'Northeast Structural Genomics Consortium (NESG)' 10 # _citation.id primary _citation.title ;Solution NMR Structure of uncharacterized protein from gene locus NE0665 of Nitrosomonas europaea. Northeast Structural Genomics Target NeR103A ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rossi, P.' 1 ? primary 'Xiao, R.' 2 ? primary 'Acton, T.' 3 ? primary 'Rost, B.' 4 ? primary 'Montelione, G.T.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 11939.336 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'sequence database residues 174-269' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDQKSSSPQPAAQAPETKQAFPRKFVLAALEQSSDDAGWANLGNFGNYLNKLQPDFDSRLYGYKKLSDLVKARTDLFVTE ERQVPGSTQKALYLRAKLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDQKSSSPQPAAQAPETKQAFPRKFVLAALEQSSDDAGWANLGNFGNYLNKLQPDFDSRLYGYKKLSDLVKARTDLFVTE ERQVPGSTQKALYLRAKLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NeR103A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 GLN n 1 4 LYS n 1 5 SER n 1 6 SER n 1 7 SER n 1 8 PRO n 1 9 GLN n 1 10 PRO n 1 11 ALA n 1 12 ALA n 1 13 GLN n 1 14 ALA n 1 15 PRO n 1 16 GLU n 1 17 THR n 1 18 LYS n 1 19 GLN n 1 20 ALA n 1 21 PHE n 1 22 PRO n 1 23 ARG n 1 24 LYS n 1 25 PHE n 1 26 VAL n 1 27 LEU n 1 28 ALA n 1 29 ALA n 1 30 LEU n 1 31 GLU n 1 32 GLN n 1 33 SER n 1 34 SER n 1 35 ASP n 1 36 ASP n 1 37 ALA n 1 38 GLY n 1 39 TRP n 1 40 ALA n 1 41 ASN n 1 42 LEU n 1 43 GLY n 1 44 ASN n 1 45 PHE n 1 46 GLY n 1 47 ASN n 1 48 TYR n 1 49 LEU n 1 50 ASN n 1 51 LYS n 1 52 LEU n 1 53 GLN n 1 54 PRO n 1 55 ASP n 1 56 PHE n 1 57 ASP n 1 58 SER n 1 59 ARG n 1 60 LEU n 1 61 TYR n 1 62 GLY n 1 63 TYR n 1 64 LYS n 1 65 LYS n 1 66 LEU n 1 67 SER n 1 68 ASP n 1 69 LEU n 1 70 VAL n 1 71 LYS n 1 72 ALA n 1 73 ARG n 1 74 THR n 1 75 ASP n 1 76 LEU n 1 77 PHE n 1 78 VAL n 1 79 THR n 1 80 GLU n 1 81 GLU n 1 82 ARG n 1 83 GLN n 1 84 VAL n 1 85 PRO n 1 86 GLY n 1 87 SER n 1 88 THR n 1 89 GLN n 1 90 LYS n 1 91 ALA n 1 92 LEU n 1 93 TYR n 1 94 LEU n 1 95 ARG n 1 96 ALA n 1 97 LYS n 1 98 LEU n 1 99 GLU n 1 100 HIS n 1 101 HIS n 1 102 HIS n 1 103 HIS n 1 104 HIS n 1 105 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene NE0665 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Nitrosomonas europaea' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 915 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) + Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET21-23C _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q82WK8_NITEU _struct_ref.pdbx_db_accession Q82WK8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DQKSSSPQPAAQAPETKQAFPRKFVLAALEQSSDDAGWANLGNFGNYLNKLQPDFDSRLYGYKKLSDLVKARTDLFVTEE RQVPGSTQKALYLRAK ; _struct_ref.pdbx_align_begin 174 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KPM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 97 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q82WK8 _struct_ref_seq.db_align_beg 174 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 269 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 97 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KPM MET A 1 ? UNP Q82WK8 ? ? 'initiating methionine' 1 1 1 2KPM LEU A 98 ? UNP Q82WK8 ? ? 'expression tag' 98 2 1 2KPM GLU A 99 ? UNP Q82WK8 ? ? 'expression tag' 99 3 1 2KPM HIS A 100 ? UNP Q82WK8 ? ? 'expression tag' 100 4 1 2KPM HIS A 101 ? UNP Q82WK8 ? ? 'expression tag' 101 5 1 2KPM HIS A 102 ? UNP Q82WK8 ? ? 'expression tag' 102 6 1 2KPM HIS A 103 ? UNP Q82WK8 ? ? 'expression tag' 103 7 1 2KPM HIS A 104 ? UNP Q82WK8 ? ? 'expression tag' 104 8 1 2KPM HIS A 105 ? UNP Q82WK8 ? ? 'expression tag' 105 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HCCH-TOCSY' 1 4 1 '3D HCCH-COSY' 1 5 1 '3D CCH-TOCSY' 1 6 1 '3D HNCO' 1 7 1 '3D HNCACB' 1 8 1 '3D HBHA(CO)NH' 1 9 1 '3D CBCA(CO)NH' 1 10 1 '3D 1H-15N NOESY' 1 11 1 '3D 1H-13C NOESY' 1 12 1 '3D HN(CA)CO' 1 13 1 '3D HNCA' 1 14 2 het-NOE 1 15 2 T1-pseudo2D 1 16 2 T2CPMG-pseudo2D 1 17 2 high-resC13-HSQC 1 18 1 '1D presat referencing' 1 19 1 '1D presat referencing' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.2 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.957 mM [U-100% 13C; U-100% 15N] protein, 200 mM sodium chloride, 20 mM MES, 10 mM DTT, 0.02 % sodium azide, 5 mM Calcium Chloride, 50 uM DSS, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.9 mM [U-5% 13C; U-100% 15N] protein, 200 mM sodium chloride, 20 mM MES, 10 mM DTT, 0.02 % sodium azide, 5 mM Calcium Chloride, 50 uM DSS, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KPM _pdbx_nmr_refine.method 'torsion angle dynamics, molecular dynamics' _pdbx_nmr_refine.details ;Iterative noesy assignment followed by torsion angle dynamics in CYANA-3.0, STRUCTURE DETERMINED BY TRIPLE RESONANCE NMR SPECTROSCOPY. NOESY ASSIGNMENTS BY CYANA-3.0. 20 OF 100 STRUCTURES LOWEST TARGET FUNCTION SELECTED WITH CYANA-3.0. SELECTED MODELS ARE FURTHER REFINED USING CNS IN EXPLICIT WATER SHELL (NILGES PROTOCOL WITH PARAM19). ASSIGNMENT STATS (ALL RESIDUES INCLUDED): BACKBONE 86.63%, SIDECHAIN 76.84%, AROMATIC (SC) 100%, STEREOSPECIFIC VL METHYL ASSIGNMENT 100%, UNAMBIGUOUS SIDECHAIN NH2 100%. STRUCTURE BASED ON 2412 NOE, 230 DIHE. MAX NOE VIOLATION: 0.23 A (1MODEL); MAX DIHE VIOLATION: 8.1 DEG. 3 TOTAL CLOSE CONTACTS PER 20 MODELS. STRUCTURE QUALITY FACTOR (PSVS 1.3): ORDERED RESIDUES RANGES: 19-98. SECONDARY STRUCTURE - ALPHA HELICES: 23-32, 42-52, 66-72. BETA STRANDS: 40-41, 90-96, 77-83. RMSD(ANG): BACKBONE 0.4, ALL HEAVY ATOMS 0.7. RAMA. DISTRIBUTION (MOLPROBITY): 97/3/0/0 PROCHECK (PSI-PHI): -0.12/-0.16 (RAW/Z), PROCHECK (ALL): 0.04/0.24 (RAW/Z), MOLPROBITY CLASH: 9.92/-0.18 (RAW/Z). RPF SCORES ALL ASSIGNED RESIDUES (FIT OF NOESY PEAKLISTS TO STRUCTURE): RECALL: 0.91, PRECISION: 0.93, F-MEASURE: 0.92, DP-SCORE: 0.79. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2KPM _pdbx_nmr_details.text ;MONOMER BY GEL FILTRATION CHROMATOGRAPHY/LIGHT SCATTERING AND BY NMR. T1/T2(CPMG). CONSISTENT WITH MOLECULAR WEIGHT OF MONOMERIC UNIT. ; # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KPM _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KPM _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 Goddard 'data analysis' Sparky 3.112 4 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE ? 5 'Shen,Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS + 6 'Bhattacharya and Montelione' validation PSVS 1.3 7 'Bruker Biospin' collection TopSpin 2.1 8 'delano scientific' visualization PyMOL 1.2 9 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KPM _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KPM _struct.title ;Solution NMR Structure of uncharacterized protein from gene locus NE0665 of Nitrosomonas europaea. Northeast Structural Genomics Target NeR103A ; _struct.pdbx_descriptor 'Uncharacterized protein' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KPM _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;methods development, uncharacterized protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 22 ? SER A 33 ? PRO A 22 SER A 33 1 ? 12 HELX_P HELX_P2 2 LEU A 42 ? GLN A 53 ? LEU A 42 GLN A 53 1 ? 12 HELX_P HELX_P3 3 ASP A 57 ? TYR A 61 ? ASP A 57 TYR A 61 5 ? 5 HELX_P HELX_P4 4 LYS A 65 ? ARG A 73 ? LYS A 65 ARG A 73 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 40 ? ASN A 41 ? ALA A 40 ASN A 41 A 2 LYS A 90 ? ALA A 96 ? LYS A 90 ALA A 96 A 3 PHE A 77 ? GLN A 83 ? PHE A 77 GLN A 83 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 40 ? N ALA A 40 O LEU A 94 ? O LEU A 94 A 2 3 O ARG A 95 ? O ARG A 95 N VAL A 78 ? N VAL A 78 # _atom_sites.entry_id 2KPM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 HIS 103 103 103 HIS HIS A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 HIS 105 105 105 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-12-15 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 0.957 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium chloride-2' 200 ? mM ? 1 MES-3 20 ? mM ? 1 DTT-4 10 ? mM ? 1 'sodium azide-5' 0.02 ? % ? 1 'Calcium Chloride-6' 5 ? mM ? 1 DSS-7 50 ? uM ? 1 protein-8 0.9 ? mM '[U-5% 13C; U-100% 15N]' 2 'sodium chloride-9' 200 ? mM ? 2 MES-10 20 ? mM ? 2 DTT-11 10 ? mM ? 2 'sodium azide-12' 0.02 ? % ? 2 'Calcium Chloride-13' 5 ? mM ? 2 DSS-14 50 ? uM ? 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 9 ? ? 62.00 97.42 2 1 ALA A 11 ? ? -77.25 40.95 3 1 GLU A 16 ? ? -91.33 -159.93 4 1 ARG A 73 ? ? -85.81 48.40 5 1 GLU A 99 ? ? -69.33 -175.48 6 1 HIS A 101 ? ? -46.03 108.57 7 2 SER A 7 ? ? 60.34 77.17 8 2 GLU A 16 ? ? -58.83 96.61 9 2 ARG A 73 ? ? -91.61 58.24 10 2 GLU A 99 ? ? -76.41 39.79 11 2 HIS A 100 ? ? 67.70 -10.79 12 2 HIS A 103 ? ? -59.67 106.95 13 3 LYS A 4 ? ? 69.43 -58.12 14 3 ALA A 11 ? ? -64.00 2.67 15 3 HIS A 102 ? ? 47.95 71.07 16 4 ALA A 11 ? ? -56.94 108.61 17 4 PRO A 15 ? ? -59.30 99.21 18 4 THR A 17 ? ? 71.91 107.16 19 5 ASP A 2 ? ? -166.50 116.31 20 5 GLN A 9 ? ? 53.92 76.03 21 5 PRO A 15 ? ? -74.16 -169.27 22 5 THR A 17 ? ? -59.17 93.35 23 5 ARG A 73 ? ? -95.65 49.71 24 5 HIS A 104 ? ? 73.18 37.87 25 6 ALA A 11 ? ? -51.37 93.73 26 6 PRO A 15 ? ? -62.27 -176.20 27 6 HIS A 100 ? ? -69.28 9.32 28 6 HIS A 102 ? ? -75.97 46.26 29 6 HIS A 103 ? ? -66.59 86.86 30 7 ARG A 73 ? ? -112.85 51.21 31 8 PRO A 8 ? ? -68.00 91.42 32 8 GLN A 9 ? ? 56.91 87.32 33 8 PRO A 15 ? ? -68.96 -169.23 34 8 THR A 17 ? ? -68.01 95.85 35 8 HIS A 100 ? ? -65.48 91.18 36 8 HIS A 101 ? ? -67.93 80.88 37 8 HIS A 102 ? ? -62.08 89.67 38 8 HIS A 104 ? ? -63.02 87.93 39 9 SER A 7 ? ? -146.12 52.68 40 9 ARG A 73 ? ? -99.37 46.08 41 9 HIS A 102 ? ? -56.36 106.19 42 10 ALA A 11 ? ? 73.13 -3.71 43 10 PRO A 15 ? ? -68.24 -164.35 44 10 ARG A 73 ? ? -109.81 51.70 45 10 HIS A 100 ? ? -164.50 -6.71 46 10 HIS A 101 ? ? 65.10 -22.74 47 11 PRO A 8 ? ? -84.71 -145.55 48 11 ARG A 73 ? ? -108.53 49.26 49 11 HIS A 101 ? ? -47.30 100.98 50 12 ASP A 2 ? ? -85.61 -76.51 51 12 HIS A 100 ? ? -71.39 26.88 52 12 HIS A 101 ? ? -144.71 36.01 53 13 HIS A 102 ? ? -141.16 -25.92 54 14 SER A 7 ? ? 52.20 82.99 55 14 PRO A 8 ? ? -88.79 34.28 56 14 ARG A 73 ? ? -92.48 53.96 57 14 HIS A 100 ? ? -160.41 111.09 58 14 HIS A 104 ? ? -172.53 112.02 59 15 ASP A 2 ? ? -133.65 -31.67 60 15 SER A 5 ? ? -68.99 78.57 61 15 ALA A 12 ? ? -64.63 97.01 62 15 ARG A 73 ? ? -101.52 57.76 63 16 GLN A 9 ? ? 61.65 84.80 64 17 SER A 5 ? ? -52.88 95.03 65 17 GLU A 16 ? ? 57.17 -82.70 66 17 ARG A 73 ? ? -113.01 54.52 67 18 PRO A 8 ? ? -59.27 93.94 68 18 ARG A 73 ? ? -117.38 50.29 69 19 LYS A 4 ? ? 59.84 9.42 70 19 SER A 7 ? ? -155.89 72.58 71 19 ARG A 73 ? ? -98.04 51.01 72 19 PRO A 85 ? ? -45.24 107.13 73 20 SER A 7 ? ? 62.66 89.53 74 20 GLN A 9 ? ? -160.29 97.28 75 20 THR A 17 ? ? -63.37 97.59 76 20 ARG A 73 ? ? -90.46 47.46 77 20 GLU A 99 ? ? -135.24 -45.13 #