data_2KPO # _entry.id 2KPO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2KPO RCSB RCSB101417 BMRB 16562 WWPDB D_1000101417 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 16562 BMRB . unspecified OR16 TargetDB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KPO _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-10-17 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Koga, R.' 2 'Koga, N.' 3 'Xiao, R.' 4 'Hamilton, K.' 5 'Ciccosanti, C.' 6 'Acton, T.B.' 7 'Baker, D.' 8 'Montelione, G.T.' 9 'Northeast Structural Genomics Consortium (NESG)' 10 # _citation.id primary _citation.title 'Solution NMR structure of denovo designed rossmann 2x2 fold protein, Northeast Structural Genomics Consortium target OR16' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Liu, G.' 1 primary 'Koga, R.' 2 primary 'Koga, N.' 3 primary 'Baker, D.' 4 primary 'Montelione, G.T.' 5 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'rossmann 2x2 fold protein' _entity.formula_weight 13077.996 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRT RKVTSPDEAKRWIKEFSEEGGSLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRT RKVTSPDEAKRWIKEFSEEGGSLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier OR16 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 LEU n 1 4 TYR n 1 5 VAL n 1 6 LEU n 1 7 ILE n 1 8 ILE n 1 9 SER n 1 10 ASN n 1 11 ASP n 1 12 LYS n 1 13 LYS n 1 14 LEU n 1 15 ILE n 1 16 GLU n 1 17 GLU n 1 18 ALA n 1 19 ARG n 1 20 LYS n 1 21 MET n 1 22 ALA n 1 23 GLU n 1 24 LYS n 1 25 ALA n 1 26 ASN n 1 27 LEU n 1 28 GLU n 1 29 LEU n 1 30 ARG n 1 31 THR n 1 32 VAL n 1 33 LYS n 1 34 THR n 1 35 GLU n 1 36 ASP n 1 37 GLU n 1 38 LEU n 1 39 LYS n 1 40 LYS n 1 41 TYR n 1 42 LEU n 1 43 GLU n 1 44 GLU n 1 45 PHE n 1 46 ARG n 1 47 LYS n 1 48 GLU n 1 49 SER n 1 50 GLN n 1 51 ASN n 1 52 ILE n 1 53 LYS n 1 54 VAL n 1 55 LEU n 1 56 ILE n 1 57 LEU n 1 58 VAL n 1 59 SER n 1 60 ASN n 1 61 ASP n 1 62 GLU n 1 63 GLU n 1 64 LEU n 1 65 ASP n 1 66 LYS n 1 67 ALA n 1 68 LYS n 1 69 GLU n 1 70 LEU n 1 71 ALA n 1 72 GLN n 1 73 LYS n 1 74 MET n 1 75 GLU n 1 76 ILE n 1 77 ASP n 1 78 VAL n 1 79 ARG n 1 80 THR n 1 81 ARG n 1 82 LYS n 1 83 VAL n 1 84 THR n 1 85 SER n 1 86 PRO n 1 87 ASP n 1 88 GLU n 1 89 ALA n 1 90 LYS n 1 91 ARG n 1 92 TRP n 1 93 ILE n 1 94 LYS n 1 95 GLU n 1 96 PHE n 1 97 SER n 1 98 GLU n 1 99 GLU n 1 100 GLY n 1 101 GLY n 1 102 SER n 1 103 LEU n 1 104 GLU n 1 105 HIS n 1 106 HIS n 1 107 HIS n 1 108 HIS n 1 109 HIS n 1 110 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'artificial gene' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET29b+ _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2KPO _struct_ref.pdbx_db_accession 2KPO _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ;MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRT RKVTSPDEAKRWIKEFSEEGGSLEHHHHHH ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KPO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 110 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2KPO _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 110 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 110 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D H(CCO)NH' 1 6 1 'GFT (4,3)D HABCABcoNHN' 1 7 1 'SIMUTANEOUS 1H, 15N, 13C NOESY' 1 8 1 '3D CCHTOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.859 mM [U-100% 13C; U-100% 15N] protein, 93% H2O/7% D2O' 1 '93% H2O/7% D2O' '0.867 mM [U-10% 13C; U-100% 15N] protein, 93% H2O/7% D2O' 2 '93% H2O/7% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker Avance 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KPO _pdbx_nmr_refine.method 'distance geometry, simulated annealing, molecular dynamics, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KPO _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KPO _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 4 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 5 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA ? 6 'Huang, Tejero, Powers and Montelione' refinement AutoStructure ? 7 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure ? 8 'Huang, Tejero, Powers and Montelione' 'geometry optimization' AutoStructure ? 9 'Bartels et al.' 'chemical shift assignment' XEASY ? 10 'Bartels et al.' 'data analysis' XEASY ? 11 'Bartels et al.' 'peak picking' XEASY ? 12 'Bruker Biospin' collection TOPSPIN ? 13 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 14 Varian collection VNMRJ ? 15 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign ? 16 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KPO _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KPO _struct.title 'Solution NMR structure of de novo designed rossmann 2x2 fold protein, Northeast Structural Genomics Consortium target OR16' _struct.pdbx_descriptor 'rossmann 2x2 fold protein' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KPO _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text ;De Novo Designed, Rossmann fold, NESG, GFT NMR, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, DE NOVO PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 11 ? ASN A 26 ? ASP A 11 ASN A 26 1 ? 16 HELX_P HELX_P2 2 THR A 34 ? ARG A 46 ? THR A 34 ARG A 46 1 ? 13 HELX_P HELX_P3 3 ASN A 60 ? MET A 74 ? ASN A 60 MET A 74 1 ? 15 HELX_P HELX_P4 4 SER A 85 ? GLU A 99 ? SER A 85 GLU A 99 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 28 ? THR A 31 ? GLU A 28 THR A 31 A 2 LEU A 2 ? ILE A 8 ? LEU A 2 ILE A 8 A 3 ILE A 52 ? VAL A 58 ? ILE A 52 VAL A 58 A 4 VAL A 78 ? LYS A 82 ? VAL A 78 LYS A 82 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 30 ? O ARG A 30 N VAL A 5 ? N VAL A 5 A 2 3 N ILE A 8 ? N ILE A 8 O LEU A 57 ? O LEU A 57 A 3 4 N VAL A 58 ? N VAL A 58 O ARG A 81 ? O ARG A 81 # _atom_sites.entry_id 2KPO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 HIS 110 110 110 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-12-01 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-06-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Structure summary' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 0.859 ? mM '[U-100% 13C; U-100% 15N]' 1 protein-2 0.867 ? mM '[U-10% 13C; U-100% 15N]' 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 47 ? ? -65.12 -70.96 2 1 GLU A 48 ? ? -90.43 32.99 3 2 GLU A 75 ? ? 62.54 74.31 4 2 HIS A 108 ? ? 68.26 -66.90 5 3 HIS A 107 ? ? -127.36 -69.63 6 4 SER A 49 ? ? -49.13 -19.40 7 4 SER A 102 ? ? -67.19 72.07 8 4 HIS A 108 ? ? -80.60 38.79 9 4 HIS A 109 ? ? 169.65 142.36 10 5 GLU A 75 ? ? 58.38 74.38 11 5 LEU A 103 ? ? -96.97 -66.52 12 5 HIS A 105 ? ? -80.59 49.76 13 5 HIS A 109 ? ? -155.18 -63.09 14 6 HIS A 107 ? ? -78.23 42.47 15 7 GLU A 75 ? ? 58.60 70.05 16 7 HIS A 106 ? ? 65.13 -3.89 17 7 HIS A 107 ? ? -59.76 99.40 18 8 SER A 102 ? ? 67.50 102.53 19 8 HIS A 105 ? ? -163.68 111.44 20 8 HIS A 109 ? ? 179.80 171.02 21 9 SER A 49 ? ? -73.40 34.04 22 9 GLU A 75 ? ? 52.82 73.33 23 10 ASN A 51 ? ? -147.07 32.42 24 10 LEU A 103 ? ? -60.54 -72.17 25 10 HIS A 106 ? ? -69.70 84.19 26 10 HIS A 109 ? ? 50.29 72.76 27 11 SER A 49 ? ? -68.99 69.24 28 11 GLN A 50 ? ? -145.42 -61.32 29 11 SER A 102 ? ? 74.69 -30.22 30 11 GLU A 104 ? ? -61.35 -72.14 31 11 HIS A 106 ? ? -66.21 81.47 32 12 SER A 49 ? ? -68.72 20.88 33 12 GLU A 75 ? ? 57.25 79.38 34 12 GLU A 104 ? ? -68.18 88.30 35 13 LYS A 47 ? ? -59.25 -70.12 36 13 GLN A 50 ? ? -121.49 -65.09 37 13 HIS A 106 ? ? -68.14 93.13 38 14 GLU A 48 ? ? -93.46 36.62 39 14 SER A 49 ? ? -68.68 15.92 40 14 GLU A 104 ? ? -67.38 -77.66 41 14 HIS A 108 ? ? -61.95 90.92 42 15 LYS A 33 ? ? -121.39 -62.10 43 15 ASN A 51 ? ? -141.88 44.47 44 15 LEU A 103 ? ? -76.01 -79.77 45 16 SER A 102 ? ? -177.27 117.43 46 17 GLU A 48 ? ? -93.39 39.85 47 17 SER A 49 ? ? -64.77 1.74 48 17 GLU A 75 ? ? 63.96 61.69 49 17 SER A 102 ? ? -165.28 107.92 50 17 HIS A 109 ? ? 69.00 100.38 51 18 GLU A 75 ? ? 50.61 76.31 52 18 HIS A 105 ? ? 60.44 -82.99 53 18 HIS A 106 ? ? 50.10 -81.91 54 18 HIS A 108 ? ? 51.07 19.83 55 19 ASN A 51 ? ? -144.07 29.66 56 19 HIS A 106 ? ? -66.33 83.47 57 19 HIS A 107 ? ? -171.36 105.29 58 19 HIS A 109 ? ? -171.68 141.28 59 20 GLU A 48 ? ? -93.81 32.35 60 20 SER A 49 ? ? -65.26 5.28 61 20 HIS A 107 ? ? -164.63 80.23 #